Property Summary

NCBI Gene PubMed Count 70
PubMed Score 219.18
PubTator Score 81.90

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (33)

PMID Text
25703136 founder haplotype analysis of FANCG for the Korean Fanconi anemia population
25477267 Patients, homozygous for the FANCG founder mutation, present with severe cytopenia but progress to bone marrow failure at similar ages to other individuals affected with Fanconi anemia of heterogeneous genotype.
25132264 A new role of FANCG in Homologous recombination repair of interstrand crosslinks through K63Ub-mediated interaction with the Rap80-BRCA1 complex.
24300640 Three novel single base pair deletions, resulting in frameshift mutations (c.247delA, c.179delT and c.899delT) were identified in patients with Fanconi anaemia
23067021 FANCA and FANCG are the major Fanconi anemia genes in the Korean population.
21750350 Areca nut extracts-induced miR-23a was correlated with a reduced FANCG expression and DSB repair, which might contribute to ANE-associated human malignancies.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20518486 sites of interaction of FANCG with ERCC1, which is different from the region of ERCC1 that binds to XPF
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19861517 Observational study of gene-disease association. (HuGE Navigator)
19690177 Observational study of gene-disease association. (HuGE Navigator)
19536649 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18212739 FANCG promotes formation of a newly identified protein complex containing BRCA2, FANCD2 and XRCC3.
17010390 Four human FANCG polymorphic variants show normal biological function.
16621732 FANCG, in addition to stabilising the FA core complex, may have a role in building multiprotein complexes that facilitate homologous recombination repair.
16609022 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16195237 Observational study of gene-disease association. (HuGE Navigator)
15319283 Primary fibroblasts from patients with Fanconi anemia with reduced FANCG expression show no signs of telomere dysfunction.
15256425 FA proteins function at the level of chromatin during S phase to regulate and maintain genomic stability.
15138265 FANCA and FANCG uniquely respond to oxidative damage by forming complexes via intermolecular disulfide linkages
15059067 A unique Fanconi-anemia-causing mutation, FANCG splice-site mutation IVS4+3A>G, showed exon 4 skipping.
12915460 FANCG interacts directly with BRCA2.
12861027 FANCG is required for efficient homologous recombination-mediated repair of at least some types of DNA double-strand breaks
12649160 FANCG was able to mediate interaction between FANCA and FANCF, as well as between monomers of FANCA
12552564 There is remarkably lage sequence variation in FANCG gene mutations and polymorphisms across ethnic and racial backgrounds found in the International Fanconi Anemia Registry they include IVS8-2A>G, IVS11+1G>c, 1794_1803del10, and IVS3+1G>C.
12432219 Study of the molecular evolution of FA genes using database search methods such as PSI-BLAST suggested that FANCG may contain a known domain, and that this protein is a member of the family of tetratricopeptide repeat-containing proteins.

AA Sequence

MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGLPAAVPVLPLE      1 - 70
LTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALH     71 - 140
RLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTA    141 - 210
FAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWG    211 - 280
PPLLEASRLYQQLGDTTAELESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHIL    281 - 350
ASRCLQTGRAGDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL    351 - 420
LSRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCLELLFRATPEE    421 - 490
KEQGAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLSVQMCPGNRDTYFHLLQTLKR    491 - 560
LDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLSWIRPSDRDAFLEEFRTSLPKSCDL            561 - 622
//

Text Mined References (71)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25703136 2015 Founder haplotype analysis of Fanconi anemia in the Korean population finds common ancestral haplotypes for a FANCG variant.
25477267 2015 Hematological consequences of a FANCG founder mutation in Black South African patients with Fanconi anemia.
25132264 2015 K63-linked ubiquitination of FANCG is required for its association with the Rap80-BRCA1 complex to modulate homologous recombination repair of DNA interstand crosslinks.
24300640 2013 Fanconi anaemia in black South African patients heterozygous for the FANCG c.637-643delTACCGCC founder mutation.
23067021 2013 FANCA and FANCG are the major Fanconi anemia genes in the Korean population.
22705371 2012 A ubiquitin-binding protein, FAAP20, links RNF8-mediated ubiquitination to the Fanconi anemia DNA repair network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
22343915 2012 FAAP20: a novel ubiquitin-binding FA nuclear core-complex protein required for functional integrity of the FA-BRCA DNA repair pathway.
22266823 2012 Regulation of Rev1 by the Fanconi anemia core complex.
21750350 2011 Areca nut induces miR-23a and inhibits repair of DNA double-strand breaks by targeting FANCG.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20518486 2010 The Fanconi anemia protein, FANCG, binds to the ERCC1-XPF endonuclease via its tetratricopeptide repeats and the central domain of ERCC1.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20347428 2010 A histone-fold complex and FANCM form a conserved DNA-remodeling complex to maintain genome stability.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19861517 2009 Predisposition for TMPRSS2-ERG fusion in prostate cancer by variants in DNA repair genes.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19536649 2009 The Fanconi anemia family of genes and its correlation with breast cancer susceptibility and breast cancer features.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19102630 2009 The SH3 domain of alphaII spectrin is a target for the Fanconi anemia protein, FANCG.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18550849 2008 HES1 is a novel interactor of the Fanconi anemia core complex.
18212739 2008 FANCG promotes formation of a newly identified protein complex containing BRCA2, FANCD2 and XRCC3.
17396147 2007 FAAP100 is essential for activation of the Fanconi anemia-associated DNA damage response pathway.
17060495 2006 Defective mitochondrial peroxiredoxin-3 results in sensitivity to oxidative stress in Fanconi anemia.
17010390 2006 Four human FANCG polymorphic variants show normal biological function in hamster CHO cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16621732 2006 Tetratricopeptide-motif-mediated interaction of FANCG with recombination proteins XRCC3 and BRCA2.
16609022 2006 Polymorphisms in genes of nucleotide and base excision repair: risk and prognosis of colorectal cancer.
16195237 2006 Polymorphisms of DNA repair genes and risk of non-small cell lung cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16116422 2005 A human ortholog of archaeal DNA repair protein Hef is defective in Fanconi anemia complementation group M.
15657175 2005 A common Fanconi anemia mutation in black populations of sub-Saharan Africa.
15502827 2004 X-linked inheritance of Fanconi anemia complementation group B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15319283 2004 Telomere dynamics in Fancg-deficient mouse and human cells.
15299030 2004 The Fanconi anemia proteins functionally interact with the protein kinase regulated by RNA (PKR).
15256425 2005 The Fanconi anemia core complex associates with chromatin during S phase.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15138265 2004 Oxidative stress/damage induces multimerization and interaction of Fanconi anemia proteins.
15059067 2004 Molecular characterization of three novel Fanconi anemia mutations in Israeli Arabs.
12915460 2003 Direct interaction of the Fanconi anaemia protein FANCG with BRCA2/FANCD1.
12861027 2003 Fanconi anemia FANCG protein in mitigating radiation- and enzyme-induced DNA double-strand breaks by homologous recombination in vertebrate cells.
12724401 2003 A multiprotein nuclear complex connects Fanconi anemia and Bloom syndrome.
12649160 2003 Fanconi anemia protein complex: mapping protein interactions in the yeast 2- and 3-hybrid systems.
12552564 2003 Spectrum of sequence variation in the FANCG gene: an International Fanconi Anemia Registry (IFAR) study.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432219 2002 Evolutionary clues to the molecular function of fanconi anemia genes.
12239156 2002 The Fanconi anemia protein, FANCE, promotes the nuclear accumulation of FANCC.
12093742 2002 FANCE: the link between Fanconi anaemia complex assembly and activity.
11918676 2002 Characterization, expression and complex formation of the murine Fanconi anaemia gene product Fancg.
11756225 2002 The FANCG Fanconi anemia protein interacts with CYP2E1: possible role in protection against oxidative DNA damage.
11157805 2001 Direct interactions of the five known Fanconi anaemia proteins suggest a common functional pathway.
11093276 2000 Spectrum of mutations in the Fanconi anaemia group G gene, FANCG/XRCC9.
11063725 2000 The Fanconi anemia protein FANCF forms a nuclear complex with FANCA, FANCC and FANCG.
11050007 2000 The fanconi anemia proteins FANCA and FANCG stabilize each other and promote the nuclear accumulation of the Fanconi anemia complex.
10807541 2000 Novel mutations of the FANCG gene causing alternative splicing in Japanese Fanconi anemia.
10652215 2000 Investigation of Fanconi anemia protein interactions by yeast two-hybrid analysis.
10627486 2000 Strong FANCA/FANCG but weak FANCA/FANCC interaction in the yeast 2-hybrid system.
10468606 1999 A physical complex of the Fanconi anemia proteins FANCG/XRCC9 and FANCA.
10468603 1999 Rare germinal unequal crossing-over leading to recombinant gene formation and gene duplication in Arabidopsis thaliana.
10373536 1999 Fanconi anemia proteins FANCA, FANCC, and FANCG/XRCC9 interact in a functional nuclear complex.
9806548 1998 The Fanconi anaemia group G gene FANCG is identical with XRCC9.
9382107 1997 Evidence for at least eight Fanconi anemia genes.
9256465 1997 The human XRCC9 gene corrects chromosomal instability and mutagen sensitivities in CHO UV40 cells.