Property Summary

NCBI Gene PubMed Count 148
PubMed Score 362.37
PubTator Score 284.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

 GO Function (1)

Protein-protein Interaction (13)

Gene RIF (117)

PMID Text
26765540 while dispensable for cell survival, FANCD2 selectively safeguards chromosomal stability after UV-triggered replication stress
26584049 Using human and murine cells defective in FANCD2 or FANCA and primary bone marrow cells derived from FANCD2 deficient mice, we show that the FA pathway removes R loops and that many DNA breaks accumulated in FA cells are R loop-dependent.
26430909 These findings indicate that FANCI functions upstream of FA core complex recruitment independently of FANCD2, and alter the current view of the FA-BRCA pathway.
26385482 Using small interfering RNA (siRNA), knockdown of FANCF, FANCL, or FANCD2 inhibited function of the FA/BRCA pathway in A549, A549/DDP and SK-MES-1 cells, and potentiated sensitivity of the three cells to cisplatin.
26336824 FANCJ protein is important for the stability of FANCD2/FANCI proteins and protects them from proteasome and caspase-3 dependent degradation.
26083937 FANCD2 is a key factor in genome stability maintenance in response to high-LET radiation
25891850 Celastrol is a FANCD2 inhibitor that could interfere with the monoubiquitination and protein stability of FANCD2.
25801034 describe a mechanism of interstrand crosslink (ICL) sensing and propose that UHRF1 is a critical factor that binds to ICLs. In turn, this binding is necessary for the subsequent recruitment of FANCD2, which allows the DNA repair process to initiate
25736055 FANCD2 plays a role in gemcitabine drug resistance in biliary tract cancer.
25659033 FANCJ and BRCA2 share FANCD2's role in replication fork restart.
25542235 By inhibiting the monoubiquitination and nuclear foci formation of FANCD2, curcumin enhances DDP-induced growth inhibitory effect and cell apoptosis in A549/DDP cells.
25489943 Defective FANCI binding is associated with fanconi anemia-related FANCD2 mutant.
25176410 FANCD2 is cleaved specifically by caspase 3 during DNA damage-induced apoptosis.
25168188 these purification methods for human FANCI and FANCD2 provide novel procedures to facilitate structural and biochemical studies of human FANCI and FANCD2.
25135477 Results indicate that FANCD2 restricts inappropriate access of FAN1 to stalled forks to prevent degradation of nascent DNA strands.
25071006 FANCD2 expression levels are strongly associated with tumour grade, revealing a potential exploitable therapeutic window to allow inhibition of the FA pathway in tumour cells, whilst sparing normal brain tissue.
25070891 Our results suggest not only that FANCD2 regulates FANCJ chromatin localization but also that FANCJ is necessary for efficient loading of FANCD2 onto chromatin following DNA damage caused by mitomycin C treatment.
24794434 Data indicate that FANCD2 primes CtIP-dependent resection during HR after ICL induction but that CtIP helps prevent illegitimate recombination in FA cells.
24787670 FANCD2 may have a significant role in the radiation resistance and virulence of alveolar rhabdomyosarcoma.
24708616 The assessment of FANCD2, RAD51, BRCA1 and BRIP1 nuclear proteins could provide important information about the patients at risk for treatment failure.
24658369 Our results demonstrate that the monoubiquitinated FANCD2 in each S-phase of normal cell cycle is required to maintain an enough number of licensed origins to initiate the normal DNA replication.
24623813 Mutations in FANCI that impair its DNA binding activity compromise DNA-stimulated FANCD2 monoubiquitination.
24556218 Study identified CtIP as a novel interaction partner of FANCD2. CtIP binds and stabilizes FANCD2 in a DNA damage- and FA core complex-independent manner, suggesting that FANCD2 monoubiquitination is dispensable for its interaction with CtIP.
24512567 mitotic catastrophe might be an important cell-death mechanism involved in the response of FA fibroblasts to ionizing radiation
24451376 a phenylalanine located at the highly conserved extreme C terminus, referred to as Phe-522, is a critical residue for mediating the monoubiquitination of the FANCD2-FANCI complex.
24278431 Our studies reveal a previously unknown mechanism for the coordinate nuclear import of a subset of FANCD2 and FANCI, a key early step in the cellular ICL response.
24036990 HHR6 and hRad18 can monoubiquitinate FANCD2 at lysine 561 in vitro. This activity may represent a novel stress response pathway.
23993743 FANCD2 binds MCM proteins and controls replisome function upon activation of s phase checkpoint signaling.FANCD2 is an effector of ATR signaling implicated in a general replisome surveillance mechanism.
23965832 Results document a novel role of an inactivated FANCD2 in upregulating DeltaNp63, advancing our understanding of how an impaired FA pathway contributes to the pathogenesis of human cancer.
23897704 our results suggest that the prognostic effect is linked to proliferation, DNA damage, and oxidative stress; simultaneous detection of FANCD2 and NQO1 provides additional prognostic value.
23852546 studies suggest that the mTOR kinase inhibitor canenhance antitumor activity of conventional chemo-drugs in vitro and in vivo by suppressing FANCD2, and consequently augmenting DNA damage leading to apoptosis
23633493 Data suggest that the mTOR pathway may promote the repair of DNA double-strand breaks by sustaining FANCD2 and provide a novel mechanism of how the Fanconi anemia pathway modulates DNA damage response and repair.
23388460 In the early phase of DNA damage response, FANCD2 plays crucial roles in recruiting pol eta to the sites of DNA damage for repair.
23357080 Four haplotypes within two genes (NBS1 and BRIP1) involved in the monoubiquitinated FANCD2-DNA damage-repair pathway are significantly associated with increased sporadic breast cancer risk.
23318456 data suggest FANCD2 may promote spontaneous SCE by influencing which double-strand break repair pathway predominates during normal S-phase progression
23063585 The ratios of FANCD2 foci-negative tumors in ovarian, lung, and breast tumor samples were 21%, 20%, and 29.4%, respectively.
22872141 FANCD2 protein and the Fanconi anemia pathway are essential to protect human lymphoblastoid cells against formaldehyde toxicity.
22855611 A CUE ubiquitin-binding domain in the FANCD2 protein is required for interaction with FANCI, retention of monoubiquitinated FANCD2, and FANCI in chromatin, and for efficient DNA interstrand crosslinks repair.
22829014 Heterozygote FANCD2 mutations are associated with childhood T Cell ALL and testicular seminoma
22828868 FANCD2 possesses nucleosome-assembly activity in vitro and FANCD2-FANCI may regulate chromatin dynamics during DNA repair
22705371 Data indicate that RNF8 and FAAP20 (C1orf86) are needed for efficient Fanconi anemia group D2 protein FANCD2 monoubiquitination.
22484854 Glioma stem cells display reduced FancD2 activation following radiation damage, most probably due to their elongated cell cycle.
21995812 Chk1 and FANCD2 signal equally and additively for senescence induction, while Chk1 is predominantly responsible for maintaining persistent cell cycle arrest.
21919919 Exposure of HeLa-ADH1B cells to ethanol results in a significant increase in acetaldehyde-DNA adducts and the activation of BRCA1 and FANCD2.
21912593 FANCD2 deficiency promotes transcriptional activity of the TNF-alpha promoter and induces overproduction of TNF-which then sustains prolonged inflammatory responses
21697891 FA DNA repair genes, FANCD2, FANCL, and FANCC, are transcriptionally upregulated differently in melanoma compared with non-melanoma skin cancer
21520247 FANCD2 is a target for caspase-mediated apoptotic pathway, which may be an early indicator for apoptotic cell death
21355096 These data suggest a key role for the E3 ligase activity of RAD18 in the recruitment of FANCD2 and FANCI to chromatin and the events leading to their ubiquitylation during S phase.
21229326 UBE2W regulates FANCD2 monoubiquitination by mechanisms different from UBE2T and HRR6.
21203397 there is a disruption of the FA/BRCA pathway in BCR/ABL cells
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20805509 found that CCAAT/enhancer binding protein delta promotes monoubiquitination of the Fanconi anemia complementation group D2 protein (FANCD2), which is necessary for its function in replication-associated DNA repair
20676667 FANCJ is recruited in response to replication stress and serves to link FANCD2 to BRCA1.
20671156 study characterizes FANI which promotes DNA interstrand cross-linking repair in a manner strictly dependent on its ability to accumulate at or near sites of DNA damage and that relies on mono-ubiquitylation of the FANCI-FANCD2 complex
20603015 Study describes how a highly conserved protein, KIAA1018/MTMR15/FAN1, that interacts with, and is recruited to sites of DNA damage by, the monoubiquitinated form of FANCD2.
20556575 FANCD2 may play a critical role in breast carcinogenesis. FANCD2 expression was significantly inversely associated with histological grade and TNM stage.
20538911 results indicate Fanconi anemia(FA)pathway promotes homologous recombination (HR)repair of DNA double-strand breaks(DSBs) by counteracting Ku70; findings suggest that FANCD2 modifies the DSBs to prevent Ku70 from binding and subverting HR
20519958 suggesting that FANCD2 is dispensable for repair of replication-associated DNA damage
20507282 The results indicate that FANCD2-sponsored apoptosis requires an interaction with Tip60 and depends on Tip60.
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363922 Results describe the subcellular location and relationship with prognostic factors and patient survival of FANCD2 in breast cancer.
20339950 FANCD2 mRNA overexpression is associated with lymph node metastasis in colorectal cancer.
20040763 The novel oxidative stress response pathway identified in this study, in which FANCD2 and FOXO3a converge, probably contributes to cellular antioxidant defense.
19861535 phosphorylation of S331 of FANCD2 is mediated by CHK1
19748364 Recruitment of fanconi anemia and breast cancer proteins to DNA damage sites is differentially governed by replication.
19729998 [review] role of FANCd2 protein in preserving genome stability
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19704162 PCNA may function as a molecular platform to facilitate the mono-ubiquitination of FANCD2 and activation of the FA-BRCA pathway
19690177 Observational study of gene-disease association. (HuGE Navigator)
19671671 The successful detection of BRCA1, FANCD2, and RAD51 foci in breast cancer biopsies irradiated ex vivo, is reported.
19609304 Inhibition of MRE11, NBS1 or RAD50 leads to a destabilization of FANCD2.
19561358 the FANCI-FANCD2 complex may participate in repair of damaged replication forks through its preferential recognition of branched structures.
19536649 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19504183 Our results suggest that large genomic deletions in BRIP1/FANCJ, PALB2/FANCN, and FANCD2 do not contribute significantly to the familial breast cancer risk in the Dutch population
19466639 the role of the central FA protein D2 (FANCD2) in determining cellular radioresistance
19465922 Data show that FANCD2 and FANCI specifically associate with common fragile site loci irrespective of whether the chromosome is broken, and that these loci are frequently interlinked through BLM-associated ultra-fine DNA bridges through mitosis.
19423727 unlike cells defective in other core complex members, FANCM(-/-) cells were proficient in monoubiquitinating FANCD2
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
19047177 Resutls show a role of FANCD2 in ALT, evidence shows that knockdown of FANCD2 rapidly causes telomere dysfunction in cells that rely on ALT to maintain telomeres.
19011769 no defect in FANCD2 ubiquitination, BRCA2 and FANCJ expression; absence of FANCN protein in three cell lines: HT, Sudhl4 and JEKO-1.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18672388 Following ERCC1 depletion, FANCD2-Ub formation is reduced and FANCD2 foci are eliminated.
18482162 In contrast to other DNA damaging agents, ethanol/acetaldehyde generated DNA strand breaks without inducing ubiquitination of FANCD2, despite increasing protein levels in the nucleus.
18475298 Carcinogen-mediated suppression of FANCD2 gene expression provides a plausible molecular mechanism for CIN in bronchogenic carcinogenesis.
18469862 Snm1B interacts with the Mre11-Rad50-Nbs1 (MRN) complex and with FancD2 further substantiating its role as a checkpoint/DNA repair protein.
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18263878 chromatin remodeling protein, Tip60, interacts directly with the FANCD2 protein
18212739 FANCG promotes formation of a newly identified protein complex containing BRCA2, FANCD2 and XRCC3.
18029388 Loss of CHK1 function impedes DNA dmage-induced FANCD2 monoubiquitination but normalizes the abnormal G2 arrest in Fanconi anemia.
17898070 Study found that Fanconi anemia pathway activation is triggered mainly by the HPV type 16 (HPV-16) E7 oncoprotein and is associated with an enhanced formation of large FANCD2 foci and recruitment of FANCD2 as well as FANCD1/BRCA2 to chromatin.
17643815 Knocking-down FANCD2 gene expression increases sensitivity of cancer cells to mitomycin C and to less extent to gamma-rays. Cell lines with significant FANCD2 depletion revealed decreased recurrence capacity.
17436244 total absence of FANCD2 does not exist in FA-D2 patients, because of constraints on viable combinations of FANCD2 mutations
17333336 FANCD2 expression is absent in 10-20% of sporadic and BRCA1-related breast cancers, indicating that somatic inactivating (epi)genetic events in FANCD2 may be important in both sporadic and hereditary breast carcinogenesis
16943440 These findings support the functional connection of ATM/ATR kinases and FANCD2 in the DNA damage response and support a role for the FA pathway in the coordination of the S phase of the cell cycle.
16679306 Observational study of gene-disease association. (HuGE Navigator)
16679306 FANCD2 single nucleotide polymorphisms may be associated with sporadic breast cancer risk
16474167 FANCL, via its WD40 region, binds the FA complex and, via its PHD, recruits an as-yet-unidentified E2 for mono-ubiquitination of FANCD2
16127171 FANCC, FANCE, and FANCD2 form a ternary complex in the Fanconi anemia DNA damage response pathway
15886296 FANCD2 mutations were also common in Microsatellite instability+ Therapy-related acute myeloid leukemia/myelodysplastic syndrome
15849361 FANCD2 bound to DNA with specificity for certain structures: double strand DNA ends and Holliday junctions
15671039 FANCD2 mediates double strand DNA break repair independently of BRCA2- and Rad51-associated homologous recombination
15650050 Human Fanconi anemia monoubiquitination pathway promotes homologous DNA repair.
15454491 The carboxy terminus of FANCD2-44 plays a critical role in sensing or repairing DNA damage.
15377654 FANCD2, which is activated by the Fanconi anemia complex, is required to maintain the G2 checkpoint
15314022 ATR checkpoint kinase and RPA1 are required for efficient FANCD2 monoubiquitination
15257300 Bloom syndrome protein and FANCD2 colocalise and co-immunoprecipitate following treatment with either DNA crosslinkers or agents inducing replication arrest
15115758 FANCD2 may have a role in the cellular response to stalled replication forks or in the repair of replication-associated double-strand breaks, irrespective of the type of primary DNA lesion
14988723 The transient slow-down of DNA synthesis was abolished in cells lacking ATR, whereas CHK1-siRNA-treated cells, NBS1 or Fanconi anemia cells showed partial S-phase arrest.
14667412 Fancd2 is essential during embryogenesis to prevent inappropriate apoptosis in neural cells and other tissues undergoing high levels of proliferative expansion, implicating this mechanism in the congenital abnormalities observed in human infants with FA.
12649160 Direct interaction between FANCE and FANCD2 involving an amino-terminal region of FANCD2 was demonstrated; this interaction may provide a link between the FA protein complex and its downstream targets.
12447395 NBS1 and FANCD2 cooperate in two distinct cellular functions, one involved in the DNA crosslink response and one involved in the S-phase checkpoint response
12239151 interacts with BRCA1 and RAD51 in S phase cell lines
12042798 may be a branch point in DNA damage response

AA Sequence

MVSKRRLSKSEDKESLTEDASKTRKQPLSKKTKKSHIANEVEENDSIFVKLLKISGIILKTGESQNQLAV      1 - 70
DQIAFQKKLFQTLRRHPSYPKIIEEFVSGLESYIEDEDSFRNCLLSCERLQDEEASMGASYSKSLIKLLL     71 - 140
GIDILQPAIIKTLFEKLPEYFFENKNSDEINIPRLIVSQLKWLDRVVDGKDLTTKIMQLISIAPENLQHD    141 - 210
IITSLPEILGDSQHADVGKELSDLLIENTSLTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPV    211 - 280
IIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFDVI    281 - 350
KSAIRYEKTISEAWIKAIENTASVSEHKVFDLVMLFIIYSTNTQTKKYIDRVLRNKIRSGCIQEQLLQST    351 - 420
FSVHYLVLKDMCSSILSLAQSLLHSLDQSIISFGSLLYKYAFKFFDTYCQQEVVGALVTHICSGNEAEVD    421 - 490
TALDVLLELVVLNPSAMMMNAVFVKGILDYLDNISPQQIRKLFYVLSTLAFSKQNEASSHIQDDMHLVIR    491 - 560
KQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERANLSDEQCTQVTSLLQLVHSCSEQSPQASAL    561 - 630
YYDEFANLIQHEKLDPKALEWVGHTICNDFQDAFVVDSCVVPEGDFPFPVKALYGLEEYDTQDGIAINLL    631 - 700
PLLFSQDFAKDGGPVTSQESGQKLVSPLCLAPYFRLLRLCVERQHNGNLEEIDGLLDCPIFLTDLEPGEK    701 - 770
LESMSAKERSFMCSLIFLTLNWFREIVNAFCQETSPEMKGKVLTRLKHIVELQIILEKYLAVTPDYVPPL    771 - 840
GNFDVETLDITPHTVTAISAKIRKKGKIERKQKTDGSKTSSSDTLSEEKNSECDPTPSHRGQLNKEFTGK    841 - 910
EEKTSLLLHNSHAFFRELDIEVFSILHCGLVTKFILDTEMHTEATEVVQLGPPELLFLLEDLSQKLESML    911 - 980
TPPIARRVPFLKNKGSRNIGFSHLQQRSAQEIVHCVFQLLTPMCNHLENIHNYFQCLAAENHGVVDGPGV    981 - 1050
KVQEYHIMSSCYQRLLQIFHGLFAWSGFSQPENQNLLYSALHVLSSRLKQGEHSQPLEELLSQSVHYLQN   1051 - 1120
FHQSIPSFQCALYLIRLLMVILEKSTASAQNKEKIASLARQFLCRVWPSGDKEKSNISNDQLHALLCIYL   1121 - 1190
EHTESILKAIEEIAGVGVPELINSPKDASSSTFPTLTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQI   1191 - 1260
HEEKLLYWNMAVRDFSILINLIKVFDSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKHREDVLSLLET   1261 - 1330
FQLDTRLLHHLCGHSKIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNCREAFWLGNLKNRDLQGEEIK   1331 - 1400
SQNSQESTADESEDDMSSQASKSKATEDGEEDEVSAGEKEQDSDESYDDSD                      1401 - 1451
//

Text Mined References (160)

PMID Year Title
26765540 2016 Chromosomal Integrity after UV Irradiation Requires FANCD2-Mediated Repair of Double Strand Breaks.
26584049 2015 The Fanconi Anemia Pathway Protects Genome Integrity from R-loops.
26430909 2015 FANCI Regulates Recruitment of the FA Core Complex at Sites of DNA Damage Independently of FANCD2.
26385482 2015 RNA interferences targeting the Fanconi anemia/BRCA pathway upstream genes reverse cisplatin resistance in drug-resistant lung cancer cells.
26336824 2015 FANCJ protein is important for the stability of FANCD2/FANCI proteins and protects them from proteasome and caspase-3 dependent degradation.
26323318 2015 NUCKS1 is a novel RAD51AP1 paralog important for homologous recombination and genome stability.
26083937 2015 FANCD2 influences replication fork processes and genome stability in response to clustered DSBs.
25891850 2015 Celastrol induces proteasomal degradation of FANCD2 to sensitize lung cancer cells to DNA crosslinking agents.
25801034 2015 UHRF1 is a sensor for DNA interstrand crosslinks and recruits FANCD2 to initiate the Fanconi anemia pathway.
25736055 2015 BRCA/Fanconi anemia pathway implicates chemoresistance to gemcitabine in biliary tract cancer.
25659033 2015 FANCD2, FANCJ and BRCA2 cooperate to promote replication fork recovery independently of the Fanconi Anemia core complex.
25542235 2015 Curcumin reverses cisplatin resistance in cisplatin-resistant lung caner cells by inhibiting FA/BRCA pathway.
25489943 2014 Defective FANCI binding by a fanconi anemia-related FANCD2 mutant.
25176410 2014 FANCD2 is a target for caspase 3 during DNA damage-induced apoptosis.
25168188 2014 Expression and purification of human FANCI and FANCD2 using Escherichia coli cells.
25135477 2014 FANCD2-controlled chromatin access of the Fanconi-associated nuclease FAN1 is crucial for the recovery of stalled replication forks.
25071006 2014 FANCD2 re-expression is associated with glioma grade and chemical inhibition of the Fanconi Anaemia pathway sensitises gliomas to chemotherapeutic agents.
25070891 2014 The Fanconi anemia proteins FANCD2 and FANCJ interact and regulate each other's chromatin localization.
24794434 2014 FANCD2 and CtIP cooperate to repair DNA interstrand crosslinks.
24787670 2014 FANCD2 is a potential therapeutic target and biomarker in alveolar rhabdomyosarcoma harboring the PAX3-FOXO1 fusion gene.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
24708616 2014 Gene expression profiling reveals activation of the FA/BRCA pathway in advanced squamous cervical cancer with intrinsic resistance and therapy failure.
24658369 2014 Basal level of FANCD2 monoubiquitination is required for the maintenance of a sufficient number of licensed-replication origins to fire at a normal rate.
24623813 2014 Regulation of FANCD2 and FANCI monoubiquitination by their interaction and by DNA.
24556218 2014 CtIP mediates replication fork recovery in a FANCD2-regulated manner.
24512567 2014 Radiation-induced mitotic catastrophe in FANCD2 primary fibroblasts.
24451376 2014 The carboxyl terminus of FANCE recruits FANCD2 to the Fanconi Anemia (FA) E3 ligase complex to promote the FA DNA repair pathway.
24278431 2013 Coordinate nuclear targeting of the FANCD2 and FANCI proteins via a FANCD2 nuclear localization signal.
24036990 2013 In vitro FANCD2 monoubiquitination by HHR6 and hRad18.
23993743 2013 FANCD2 binds MCM proteins and controls replisome function upon activation of s phase checkpoint signaling.
23965832 2013 A hidden role of the inactivated FANCD2: upregulating ?Np63.
23897704 2013 Overabundant FANCD2, alone and combined with NQO1, is a sensitive marker of adverse prognosis in breast cancer.
23852546 2014 mTOR kinase inhibitor sensitizes T-cell lymphoblastic leukemia for chemotherapy-induced DNA damage via suppressing FANCD2 expression.
23633493 2013 Regulation of FANCD2 by the mTOR pathway contributes to the resistance of cancer cells to DNA double-strand breaks.
23388460 2013 Recruitment of DNA polymerase eta by FANCD2 in the early response to DNA damage.
23357080 2013 Haplotype analysis of eight genes of the monoubiquitinated FANCD2-DNA damage-repair pathway in breast cancer patients.
23318456 2013 Reduced FANCD2 influences spontaneous SCE and RAD51 foci formation in uveal melanoma and Fanconi anaemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23063585 2013 Assessment of FANCD2 nuclear foci formation in paraffin-embedded tumors: a potential patient-enrichment strategy for treatment with DNA interstrand crosslinking agents.
22872141 2013 The impact of FANCD2 deficiency on formaldehyde-induced toxicity in human lymphoblastoid cell lines.
22855611 2012 Regulation of the Fanconi anemia pathway by a CUE ubiquitin-binding domain in the FANCD2 protein.
22829014 2012 Heterozygote FANCD2 mutations associated with childhood T Cell ALL and testicular seminoma.
22828868 2012 Histone chaperone activity of Fanconi anemia proteins, FANCD2 and FANCI, is required for DNA crosslink repair.
22705371 2012 A ubiquitin-binding protein, FAAP20, links RNF8-mediated ubiquitination to the Fanconi anemia DNA repair network.
22484854 2012 Delayed formation of FancD2 foci in glioma stem cells treated with ionizing radiation.
21995812 2011 Differential roles for Chk1 and FANCD2 in ATR-mediated signalling for psoralen photoactivation-induced senescence.
21919919 2011 Alcohol metabolism in human cells causes DNA damage and activates the Fanconi anemia-breast cancer susceptibility (FA-BRCA) DNA damage response network.
21912593 2011 Direct inhibition of TNF-? promoter activity by Fanconi anemia protein FANCD2.
21697891 2011 Upregulation of Fanconi anemia DNA repair genes in melanoma compared with non-melanoma skin cancer.
21520247 2011 Fanconi anemia D2 protein is an apoptotic target mediated by caspases.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21355096 2011 The E3 ubiquitin ligase RAD18 regulates ubiquitylation and chromatin loading of FANCD2 and FANCI.
21269460 2011 Initial characterization of the human central proteome.
21229326 2011 UBE2W interacts with FANCL and regulates the monoubiquitination of Fanconi anemia protein FANCD2.
21203397 2010 Bcr/Abl interferes with the Fanconi anemia/BRCA pathway: implications in the chromosomal instability of chronic myeloid leukemia cells.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20805509 2010 CCAAT/enhancer binding protein delta (C/EBPdelta, CEBPD)-mediated nuclear import of FANCD2 by IPO4 augments cellular response to DNA damage.
20676667 2010 FANCJ/BRIP1 recruitment and regulation of FANCD2 in DNA damage responses.
20671156 2010 FAN1 acts with FANCI-FANCD2 to promote DNA interstrand cross-link repair.
20603073 2010 A genetic screen identifies FAN1, a Fanconi anemia-associated nuclease necessary for DNA interstrand crosslink repair.
20603016 2010 Deficiency of FANCD2-associated nuclease KIAA1018/FAN1 sensitizes cells to interstrand crosslinking agents.
20603015 2010 Identification of KIAA1018/FAN1, a DNA repair nuclease recruited to DNA damage by monoubiquitinated FANCD2.
20556575 2010 Expression of FANCD2 in sporadic breast cancer and clinicopathological analysis.
20538911 2010 Ku70 corrupts DNA repair in the absence of the Fanconi anemia pathway.
20519958 2010 A novel role for Fanconi anemia (FA) pathway effector protein FANCD2 in cell cycle progression of untransformed primary human cells.
20507282 2010 A FANCD2 domain activates Tip60-dependent apoptosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363922 2010 Significance of the Fanconi anemia FANCD2 protein in sporadic and metastatic human breast cancer.
20339950 2010 FANCD2 mRNA overexpression is a bona fide indicator of lymph node metastasis in human colorectal cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20040763 2010 Oxidative stress-specific interaction between FANCD2 and FOXO3a.
19995904 2010 DNA polymerase POLN participates in cross-link repair and homologous recombination.
19861535 2009 Fanconi anemia complementation group FANCD2 protein serine 331 phosphorylation is important for fanconi anemia pathway function and BRCA2 interaction.
19748364 2009 Recruitment of fanconi anemia and breast cancer proteins to DNA damage sites is differentially governed by replication.
19729998 2009 The FANC pathway and mitosis: a replication legacy.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19704162 2009 Functional interaction between the Fanconi Anemia D2 protein and proliferating cell nuclear antigen (PCNA) via a conserved putative PCNA interaction motif.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19671671 2009 Utility of DNA repair protein foci for the detection of putative BRCA1 pathway defects in breast cancer biopsies.
19609304 2009 MRE11-RAD50-NBS1 is a critical regulator of FANCD2 stability and function during DNA double-strand break repair.
19561358 2009 FANCI protein binds to DNA and interacts with FANCD2 to recognize branched structures.
19536649 2009 The Fanconi anemia family of genes and its correlation with breast cancer susceptibility and breast cancer features.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19504183 2009 Lack of large genomic deletions in BRIP1, PALB2, and FANCD2 genes in BRCA1/2 negative familial breast cancer.
19466639 2009 FANCD2-deficient human fibroblasts are hypersensitive to ionising radiation at oxygen concentrations of 0% and 3% but not under normoxic conditions.
19465922 2009 Replication stress induces sister-chromatid bridging at fragile site loci in mitosis.
19465921 2009 The FANC pathway and BLM collaborate during mitosis to prevent micro-nucleation and chromosome abnormalities.
19423727 2009 Impaired FANCD2 monoubiquitination and hypersensitivity to camptothecin uniquely characterize Fanconi anemia complementation group M.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19111657 2008 Mechanistic insight into site-restricted monoubiquitination of FANCD2 by Ube2t, FANCL, and FANCI.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
19047177 2008 HPV-16 E7 reveals a link between DNA replication stress, fanconi anemia D2 protein, and alternative lengthening of telomere-associated promyelocytic leukemia bodies.
19011769 2008 Defects of FA/BRCA pathway in lymphoma cell lines.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18672388 ERCC1 is required for FANCD2 focus formation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18482162 2008 Alcohol induces DNA damage and the Fanconi anemia D2 protein implicating FANCD2 in the DNA damage response pathways in brain.
18475298 2008 Cigarette smoke induces genetic instability in airway epithelial cells by suppressing FANCD2 expression.
18469862 2008 Snm1B/Apollo mediates replication fork collapse and S Phase checkpoint activation in response to DNA interstrand cross-links.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18263878 2008 Tip60 is required for DNA interstrand cross-link repair in the Fanconi anemia pathway.
18212739 2008 FANCG promotes formation of a newly identified protein complex containing BRCA2, FANCD2 and XRCC3.
18082604 2007 A UAF1-containing multisubunit protein complex regulates the Fanconi anemia pathway.
18029388 2008 Loss of CHK1 function impedes DNA damage-induced FANCD2 monoubiquitination but normalizes the abnormal G2 arrest in Fanconi anemia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17898070 2007 The human papillomavirus type 16 E7 oncoprotein activates the Fanconi anemia (FA) pathway and causes accelerated chromosomal instability in FA cells.
17643815 2007 FANCD2 depletion sensitizes cancer cells repopulation ability in vitro.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17460694 2007 FANCI is a second monoubiquitinated member of the Fanconi anemia pathway.
17436244 2007 Hypomorphic mutations in the gene encoding a key Fanconi anemia protein, FANCD2, sustain a significant group of FA-D2 patients with severe phenotype.
17412408 2007 Identification of the FANCI protein, a monoubiquitinated FANCD2 paralog required for DNA repair.
17333336 2008 Loss of expression of FANCD2 protein in sporadic and hereditary breast cancer.
16943440 2006 Phosphorylation of FANCD2 on two novel sites is required for mitomycin C resistance.
16916645 2006 UBE2T is the E2 in the Fanconi anemia pathway and undergoes negative autoregulation.
16679306 2006 FANCD2 associated with sporadic breast cancer risk.
16474167 2006 The WD40 repeats of FANCL are required for Fanconi anemia core complex assembly.
16127171 2005 FANCC, FANCE, and FANCD2 form a ternary complex essential to the integrity of the Fanconi anemia DNA damage response pathway.
16116422 2005 A human ortholog of archaeal DNA repair protein Hef is defective in Fanconi anemia complementation group M.
15886296 2005 Repeated sequences in CASPASE-5 and FANCD2 but not NF1 are targets for mutation in microsatellite-unstable acute leukemia/myelodysplastic syndrome.
15849361 2005 Direct DNA binding activity of the Fanconi anemia D2 protein.
15694335 2005 The deubiquitinating enzyme USP1 regulates the Fanconi anemia pathway.
15671039 2005 Fanconi anemia complementation group D2 (FANCD2) functions independently of BRCA2- and RAD51-associated homologous recombination in response to DNA damage.
15661754 2005 The Fanconi anemia pathway is required for the DNA replication stress response and for the regulation of common fragile site stability.
15650050 2005 Human Fanconi anemia monoubiquitination pathway promotes homologous DNA repair.
15502827 2004 X-linked inheritance of Fanconi anemia complementation group B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454491 2005 Regulated interaction of the Fanconi anemia protein, FANCD2, with chromatin.
15377654 2004 A role for the Fanconi anemia C protein in maintaining the DNA damage-induced G2 checkpoint.
15314022 2004 ATR couples FANCD2 monoubiquitination to the DNA-damage response.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15257300 2004 BLM and the FANC proteins collaborate in a common pathway in response to stalled replication forks.
15199141 2004 Functional interaction of monoubiquitinated FANCD2 and BRCA2/FANCD1 in chromatin.
15115758 2004 Direct interaction of FANCD2 with BRCA2 in DNA damage response pathways.
14988723 2004 The DNA crosslink-induced S-phase checkpoint depends on ATR-CHK1 and ATR-NBS1-FANCD2 pathways.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667412 2003 Knockdown of zebrafish Fancd2 causes developmental abnormalities via p53-dependent apoptosis.
14517836 2003 FANCD2 protein is expressed in proliferating cells of human tissues that are cancer-prone in Fanconi anaemia.
12973351 2003 A novel ubiquitin ligase is deficient in Fanconi anemia.
12874027 2003 Menin associates with FANCD2, a protein involved in repair of DNA damage.
12649160 2003 Fanconi anemia protein complex: mapping protein interactions in the yeast 2- and 3-hybrid systems.
12607005 2003 MDC1 is a mediator of the mammalian DNA damage checkpoint.
12607003 2003 MDC1 is required for the intra-S-phase DNA damage checkpoint.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447395 2002 Interaction of FANCD2 and NBS1 in the DNA damage response.
12389351 2002 The molecular biology of Fanconi anemia.
12239151 2002 S-phase-specific interaction of the Fanconi anemia protein, FANCD2, with BRCA1 and RAD51.
12093742 2002 FANCE: the link between Fanconi anaemia complex assembly and activity.
12086603 2002 Convergence of the fanconi anemia and ataxia telangiectasia signaling pathways.
11751423 2001 The Chinese hamster FANCG/XRCC9 mutant NM3 fails to express the monoubiquitinated form of the FANCD2 protein, is hypersensitive to a range of DNA damaging agents and exhibits a normal level of spontaneous sister chromatid exchange.
11733219 2001 Chromosomal breakage syndromes and the BRCA1 genome surveillance complex.
11239454 2001 Interaction of the Fanconi anemia proteins and BRCA1 in a common pathway.
11239453 2001 Positional cloning of a novel Fanconi anemia gene, FANCD2.
10762542 2000 Localization of the Fanconi anemia complementation group D gene to a 200-kb region on chromosome 3p25.3.
7581463 1995 Microcell mediated chromosome transfer maps the Fanconi anaemia group D gene to chromosome 3p.