Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.89
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IZT9 B2R9G7 Q5HYJ6
Symbols TEX39C

Gene

  Ortholog (2)

Gene RIF (2)

AA Sequence

MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDI      1 - 70
AADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDG     71 - 140
EKEEQIKIFQEQQKRWQQDGKGTERD                                                141 - 166
//

Text Mined References (8)

PMID Year Title