Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.89
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IZT9 B2R9G7 Q5HYJ6
Symbols TEX39C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDI      1 - 70
AADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDG     71 - 140
EKEEQIKIFQEQQKRWQQDGKGTERD                                                141 - 166
//

Text Mined References (8)

PMID Year Title