Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.89
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IZT9 B2R9G7 Q5HYJ6
Symbols TEX39C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
23836295 FAM9C overexpression increased the phosphorylation levels of Akt and anti-apoptotic ability in hepatocellular carcinoma.
12213195 Expressed exclusively in testis; protein is located in the nucleus.

AA Sequence

MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDI      1 - 70
AADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDG     71 - 140
EKEEQIKIFQEQQKRWQQDGKGTERD                                                141 - 166
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23836295 2013 FAM9C plays an anti-apoptotic role through activation of the PI3K/Akt pathway in human hepatocellular carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213195 2002 A new gene family (FAM9) of low-copy repeats in Xp22.3 expressed exclusively in testis: implications for recombinations in this region.