Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.71
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.300 8.2e-03
hepatocellular carcinoma 1.500 1.2e-05
pancreatic cancer 1.500 5.7e-03
acute quadriplegic myopathy 1.142 1.9e-06
intraductal papillary-mucinous carcinoma... 1.100 2.3e-02
pancreatic carcinoma 1.500 5.7e-03
Pick disease 1.100 1.4e-03
ovarian cancer -1.700 5.0e-04

Synonym

Accession Q52LJ0 A8MUW5 Q8N935
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
24608264 hCLE/C14orf166 associates with DDX1, HSPC117, and FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
22174317 HIV-1 Rev interacting protein, family with sequence similarity 98, member B (FAM98B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with FAM98B is increased by RRE

AA Sequence

MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESIT      1 - 70
SAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQL     71 - 140
DKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERI    141 - 210
NDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSK    211 - 280
IIRTSSGTSREKTACAINKVGVSFSTVENELMISYLMFLQILVYFSFMSW                        281 - 330
//

Text Mined References (15)

PMID Year Title
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24870230 2014 Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
24608264 2014 hCLE/C14orf166 associates with DDX1-HSPC117-FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
24132900 2013 Genome-wide association study of atypical psychosis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21311021 2011 HSPC117 is the essential subunit of a human tRNA splicing ligase complex.
21269460 2011 Initial characterization of the human central proteome.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.