Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.71
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.142 1.9e-06
gastric cancer 1.300 8.2e-03
hepatocellular carcinoma 1.500 1.2e-05
intraductal papillary-mucinous carcinoma... 1.100 2.3e-02
ovarian cancer -1.700 5.0e-04
pancreatic cancer 1.500 5.7e-03
pancreatic carcinoma 1.500 5.7e-03
Pick disease 1.100 1.4e-03

Synonym

Accession Q52LJ0 A8MUW5 Q8N935
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESIT      1 - 70
SAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQL     71 - 140
DKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERI    141 - 210
NDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSK    211 - 280
IIRTSSGTSREKTACAINKVGVSFSTVENELMISYLMFLQILVYFSFMSW                        281 - 330
//

Text Mined References (16)

PMID Year Title