Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.52
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma -1.300 6.9e-03
Multiple myeloma 1.296 6.1e-03
astrocytic glioma -1.300 2.5e-02
osteosarcoma 4.194 1.4e-07
intraductal papillary-mucinous adenoma (... 2.000 9.0e-04
intraductal papillary-mucinous carcinoma... 1.200 6.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.4e-02
lung cancer 1.500 1.8e-03
sarcoidosis 1.900 3.4e-03
non primary Sjogren syndrome sicca -1.100 2.2e-02
psoriasis 1.100 5.7e-05
Pick disease 1.800 2.9e-04
ovarian cancer 2.500 1.9e-04
pituitary cancer -2.200 1.6e-05

Synonym

Accession Q8NCA5 B2RNA2 Q9Y3Y6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
22190034 HIV-1 Tat is identified to have a physical interaction with family with sequence similarity 98, member A (FAM98A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPS      1 - 70
EAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGS     71 - 140
EVFQELKGICIALGMSKPPANITMFQFFSGIEKKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQ    141 - 210
AIANEYEVRRKLLIKRLDVTVQSFGWSDRAKSQTEKLAKVYQPKRSVLSPKTTISVAHLLAARQDLSKIL    211 - 280
RTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYG    281 - 350
GRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYRDSGFQPGGYHGGHSSGGYQ    351 - 420
GGGYGGFQTSSSYTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWGGRGSQNYH    421 - 490
QGGQFEQHFQHGGYQYNHSGFGQGRHYTS                                             491 - 519
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24257188 2014 A divergent calponin homology (NN-CH) domain defines a novel family: implications for evolution of ciliary IFT complex B proteins.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19421330 2009 Genome-wide association study of young-onset hypertension in the Han Chinese population of Taiwan.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.