Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.52
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.300 2.5e-02
hepatocellular carcinoma -1.300 6.9e-03
intraductal papillary-mucinous adenoma (... 1.100 2.2e-03
intraductal papillary-mucinous carcinoma... 1.200 6.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.4e-02
lung cancer 1.500 1.8e-03
Multiple myeloma 1.296 6.1e-03
non primary Sjogren syndrome sicca -1.100 2.2e-02
osteosarcoma 4.194 1.4e-07
ovarian cancer -1.200 2.8e-04
Pick disease 1.800 2.9e-04
pituitary cancer -1.300 1.3e-07
psoriasis 1.100 5.7e-05
sarcoidosis 1.900 3.4e-03

Gene RIF (3)

AA Sequence

MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPS      1 - 70
EAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGS     71 - 140
EVFQELKGICIALGMSKPPANITMFQFFSGIEKKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQ    141 - 210
AIANEYEVRRKLLIKRLDVTVQSFGWSDRAKSQTEKLAKVYQPKRSVLSPKTTISVAHLLAARQDLSKIL    211 - 280
RTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYG    281 - 350
GRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYRDSGFQPGGYHGGHSSGGYQ    351 - 420
GGGYGGFQTSSSYTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWGGRGSQNYH    421 - 490
QGGQFEQHFQHGGYQYNHSGFGQGRHYTS                                             491 - 519
//

Text Mined References (14)

PMID Year Title