Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.83
PubTator Score 6.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.964 1.7e-06
ovarian cancer -1.200 2.9e-04
pancreatic ductal adenocarcinoma liver m... -1.297 2.4e-03
psoriasis 1.800 7.8e-04

Gene RIF (7)

AA Sequence

MVGGGGVGGGLLENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQ      1 - 70
VRVQVSDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKE     71 - 140
RVAAALENTHLLEVVNQCLSARS                                                   141 - 163
//

Text Mined References (23)

PMID Year Title