Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.07

Knowledge Summary


No data available



  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 7.000 5.2e-24
non-small cell lung cancer -1.169 1.7e-04
nasopharyngeal carcinoma -3.700 8.8e-08
Endometriosis -1.312 3.2e-02
Pick disease 1.700 3.0e-02
pituitary cancer -1.100 1.4e-02
psoriasis -1.100 1.6e-04

Gene RIF (1)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

QQIQKTKMDLEKYKVQKDLKKLQRKIVELQEV                                          421 - 452

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.