Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.4e-04
group 3 medulloblastoma 1.600 9.8e-03
medulloblastoma, large-cell 1.100 2.7e-04
ovarian cancer -1.400 3.0e-04
primitive neuroectodermal tumor 1.400 2.0e-04
progressive supranuclear palsy -1.100 2.0e-02

Gene RIF (1)

AA Sequence

MAASALYACTKCTQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQESKTNTICKKCAQNVKQFGTP      1 - 70
KPCQYCNIIAAFIGTKCQRCTNSEKKYGPPQTCEQCKQQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQ     71 - 140
KTKEQRKSLGSSHSNSSSSSLTEKDQHHPKHHHHHHHHHHRHSSSHHKISNLSPEEEQGLWKQSHKSSAT    141 - 210
IQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKLTEL    211 - 280
KADFQYQESNLRTKMNSMEKAHKETVEQLQAKNRELLKQVAALSKGKKFDKSGSILTSP               281 - 339
//

Text Mined References (27)

PMID Year Title