Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.74
PubTator Score 7.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5TYM5 B2RV15 Q5TYM4
Symbols LMPIP
Ugene

Gene

  Ortholog (1)

Species Source Disease
OMA EggNOG

Gene RIF (5)

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLK      1 - 70
DIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVL     71 - 140
NISAEECIR                                                                 141 - 149
//

Text Mined References (11)

PMID Year Title