Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.39
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.532 1.0e-07
medulloblastoma -1.300 3.5e-04
atypical teratoid / rhabdoid tumor -1.300 3.2e-07
medulloblastoma, large-cell -1.200 8.4e-05
posterior fossa group B ependymoma 1.200 5.6e-04

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MARAAGARGPAGWCRRRGRCGRGTLLAFAAWTAGWVLAAALLLRAHPGVLSERCTDEKSRRILAALCQDY      1 - 70
QGGTLAGDLCEDLCVAGELLFQRCLHYNRGKKVLQADWRGRPVVLKSKEEAFSSFPPLSLLEEEAGEGGQ     71 - 140
DMPEAELLLMVAGEVKSALGLELSNSSLGPWWPGRRGPRWRGQLASLWALLQQEEYVYFSLLQDLSPHVL    141 - 210
PVLGSCGHFYAVEFLAAGSPHHRALFPLDRAPGAPGGGQAKAISDIALSFLDMVNHFDSDFSHRLHLCDI    211 - 280
KPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTGDEDCNFFDCFSRCDLRVNKCGAQRVNNNLQVIC    281 - 350
DKIFRHWFSAPLKSSAVSFQLQLQLQEAVQECADPGVPSGNTRRAASSVFWKLRQLLQATLRELQEAEK     351 - 419
//

Text Mined References (6)

PMID Year Title
23840464 2013 A novel predicted calcium-regulated kinase family implicated in neurological disorders.
21334309 2011 Characterisation of the FAM69 family of cysteine-rich endoplasmic reticulum proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.