Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.31
PubTator Score 11.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.814 4.0e-02
oligodendroglioma -1.800 2.1e-02
cutaneous lupus erythematosus 1.700 5.3e-03
astrocytoma -1.700 2.2e-15
glioblastoma -2.400 1.2e-04
osteosarcoma -1.976 4.6e-02
medulloblastoma, large-cell -2.800 3.0e-04
juvenile dermatomyositis 1.137 3.7e-07
tuberculosis and treatment for 3 months 1.200 9.5e-04
non-small cell lung cancer -1.417 2.9e-11
interstitial cystitis 1.900 2.0e-03
cystic fibrosis -1.900 2.1e-02
pediatric high grade glioma -1.600 5.6e-03
pilocytic astrocytoma -1.700 4.1e-03
posterior fossa group A ependymoma -1.800 2.2e-04
primary Sjogren syndrome 2.000 1.4e-04
lung adenocarcinoma -1.500 2.8e-06
nasopharyngeal carcinoma -2.000 2.1e-03
severe Alzheimer's disease -1.141 3.0e-02
lung carcinoma -2.000 5.1e-23
spina bifida -1.328 3.7e-02
ulcerative colitis 2.200 5.4e-04
ovarian cancer -3.000 1.2e-07
dermatomyositis 1.300 1.8e-03

Gene RIF (5)

PMID Text
25588844 These data together elucidate a mechanism for RHOA and pMLC polarization in stimulated neutrophils through direct inhibition of RHOA by FAM65B at the leading edge.
24958875 show that wild-type Fam65b is expressed during embryonic and postnatal development stages in murine cochlea, and that the protein localizes to the plasma membranes of the stereocilia of inner and outer hair cells of the inner ear
24687993 Fam65b expression is necessary for the complex to form.
21190562 PC3 tumors are sustained by a small number of tumor-initiating cells with stem-like characteristics, including strong self-renewal and pro-angiogenic capability and marked by the expression pattern FAM65Bhigh/MFI2low/LEF1low.
17150207 C6ORF32 is a novel protein likely to play multiple functions, including promoting myogenic cell differentiation, cytoskeletal rearrangement and filopodia formation

AA Sequence

MLVGSQSFSPGGPNGIIRSQSFAGFSGLQERRSRCNSFIENSSALKKPQAKLKKMHNLGHKNNNPPKEPQ      1 - 70
PKRVEEVYRALKNGLDEYLEVHQTELDKLTAQLKDMKRNSRLGVLYDLDKQIKTIERYMRRLEFHISKVD     71 - 140
ELYEAYCIQRRLQDGASKMKQAFATSPASKAARESLTEINRSFKEYTENMCTIEVELENLLGEFSIKMKG    141 - 210
LAGFARLCPGDQYEIFMKYGRQRWKLKGKIEVNGKQSWDGEETVFLPLIVGFISIKVTELKGLATHILVG    211 - 280
SVTCETKELFAARPQVVAVDINDLGTIKLNLEITWYPFDVEDMTASSGAGNKAAALQRRMSMYSQGTPET    281 - 350
PTFKDHSFFRWLHPSPDKPRRLSVLSALQDTFFAKLHRSRSFSDLPSLRPSPKAVLELYSNLPDDIFENG    351 - 420
KAAEEKMPLSLSFSDLPNGDCALTSHSTGSPSNSTNPEITITPAEFNLSSLASQNEGMDDTSSASSRNSL    421 - 490
GEGQEPKSHLKEEDPEEPRKPASAPSEACRRQSSGAGAEHLFLENDVAEALLQESEEASELKPVELDTSE    491 - 560
GNITKQLVKRLTSAEVPMATDRLLSEGSVGGESEGCRSFLDGSLEDAFNGLLLALEPHKEQYKEFQDLNQ    561 - 630
EVMNLDDILKCKPAVSRSRSSSLSLTVESALESFDFLNTSDFDEEEDGDEVCNVGGGADSVFSDTETEKH    631 - 700
SYRSVHPEARGHLSEALTEDTGVGTSVAGSPLPLTTGNESLDITIVRHLQYCTQLVQQIVFSSKTPFVAR    701 - 770
SLLEKLSRQIQVMEKLAAVSDENIGNISSVVEAIPEFHKKLSLLSFWTKCCSPVGVYHSPADRVMKQLEA    771 - 840
SFARTVNKEYPGLADPVFRTLVSQILDRAEPLLSSSLSSEVVTVFQYYSYFTSHGVSDLESYLSQLARQV    841 - 910
SMVQTLQSLRDEKLLQTMSDLAPSNLLAQQEVLRTLALLLTREDNEVSEAVTLYLAAASKNQHFREKALL    911 - 980
YYCEALTKTNLQLQKAACLALKILEATESIKMLVTLCQSDTEEIRNVASETLLSLGEDGRLAYEQLDKFP    981 - 1050
RDCVKVGGRHGTEVATAF                                                       1051 - 1068
//

Text Mined References (20)

PMID Year Title
27556504 2016 FAM65B controls the proliferation of transformed and primary T cells.
25588844 2015 Front-signal-dependent accumulation of the RHOA inhibitor FAM65B at leading edges polarizes neutrophils.
25416956 2014 A proteome-scale map of the human interactome network.
24958875 2014 FAM65B is a membrane-associated protein of hair cell stereocilia required for hearing.
24687993 2014 Fam65b is important for formation of the HDAC6-dysferlin protein complex during myogenic cell differentiation.
22554406 2012 Family-based genome-wide association study of frontal ? oscillations identifies potassium channel gene KCNJ6.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21190562 2010 PC3 prostate tumor-initiating cells with molecular profile FAM65Bhigh/MFI2low/LEF1low increase tumor angiogenesis.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
17825087 2008 Identification and characterization of a novel neural cell adhesion molecule (NCAM)-associated protein from quail myoblasts: relationship to myotube formation and induction of neurite-like protrusions.
17150207 2007 C6ORF32 is upregulated during muscle cell differentiation and induces the formation of cellular filopodia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12369935 2001 Life and death in the placenta: new peptides and genes regulating human syncytiotrophoblast and extravillous cytotrophoblast lineage formation and renewal.
9786461 1998 Functional regulation of human trophoblast differentiation.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9055809 1997 PL48: a novel gene associated with cytotrophoblast and lineage-specific HL-60 cell differentiation.