Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.50
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
Gaucher disease type 1 -1.100 3.0e-02
group 4 medulloblastoma -1.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.200 4.4e-02
osteosarcoma 1.733 4.3e-04
ovarian cancer -1.100 4.3e-05
psoriasis -1.500 4.8e-04
spina bifida -1.255 3.1e-02

Gene RIF (1)

AA Sequence

MESSPESLQPLEHGVAAGPASGTGSSQEGLQETRLAAGDGPGVWAAETSGGNGLGAAAARRSLPDSASPA      1 - 70
GSPEVPGPCSSSAGLDLKDSGLESPAAAEAPLRGQYKVTASPETAVAGVGHELGTAGDAGARPDLAGTCQ     71 - 140
AELTAAGSEEPSSAGGLSSSCSDPSPPGESPSLDSLESFSNLHSFPSSCEFNSEEGAENRVPEEEEGAAV    141 - 210
LPGAVPLCKEEEGEETAQVLAASKERFPGQSVYHIKWIQWKEENTPIITQNENGPCPLLAILNVLLLAWK    211 - 280
VKLPPMMEIITAEQLMEYLGDYMLDAKPKEISEIQRLNYEQNMSDAMAILHKLQTGLDVNVRFTGVRVFE    281 - 350
YTPECIVFDLLDIPLYHGWLVDPQIDDIVKAVGNCSYNQLVEKIISCKQSDNSELVSEGFVAEQFLNNTA    351 - 420
TQLTYHGLCELTSTVQEGELCVFFRNNHFSTMTKYKGQLYLLVTDQGFLTEEKVVWESLHNVDGDGNFCD    421 - 490
SEFHLRPPSDPETVYKGQQDQIDQDYLMALSLQQEQQSQEINWEQIPEGISDLELAKKLQEEEDRRASQY    491 - 560
YQEQEQAAAAAAAASTQAQQGQPAQASPSSGRQSGNSERKRKEPREKDKEKEKEKNSCVIL             561 - 621
//

Text Mined References (11)

PMID Year Title