Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.72
PubTator Score 7.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 1.6e-18

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 1.6e-18

Synonym

Accession Q9NP50 D3DUV8 Q9BSZ8
Symbols L4
TERA
FAM60A
C12orf14

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 GO Component (1)

Gene RIF (2)

AA Sequence

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGS      1 - 70
KKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQ     71 - 140
SDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQG    141 - 210
PEPLPISTQEW                                                               211 - 221
//

Text Mined References (18)

PMID Year Title