Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.46
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis 1.203 1.1e-02
Astrocytoma, Pilocytic 1.600 5.3e-08
atypical teratoid / rhabdoid tumor 1.200 1.8e-04
colon cancer 1.200 1.3e-02
cutaneous lupus erythematosus -2.000 4.7e-03
ependymoma 1.400 2.9e-10
glioblastoma 1.200 1.5e-05
interstitial cystitis -1.100 3.5e-03
intraductal papillary-mucinous carcinoma... 1.100 2.6e-03
non-small cell lung cancer 1.309 4.5e-14

Gene RIF (3)

AA Sequence

MLLTLAGGALFFPGLFALCTWALRRSQPGWSRTDCVMISTRLVSSVHAVLATGSGIVIIRSCDDVITGRH      1 - 70
WLAREYVWFLIPYMIYDSYAMYLCEWCRTRDQNRAPSLTLRNFLSRNRLMITHHAVILFVLVPVAQRLRG     71 - 140
DLGDFFVGCIFTAELSTPFVSLGRVLIQLKQQHTLLYKVNGILTLATFLSCRILLFPFMYWSYGRQQGLS    141 - 210
LLQVPFSIPFYCNVANAFLVAPQIYWFCLLCRKAVRLFDTPQAKKDG                           211 - 257
//

Text Mined References (11)

PMID Year Title