Property Summary

NCBI Gene PubMed Count 10
PubMed Score 50.62
PubTator Score 16.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Cocaine Dependence 51
Disease Target Count P-value
lung adenocarcinoma 2716 4.6e-11
osteosarcoma 7950 1.8e-05
Disease Target Count Z-score Confidence
Schistosomiasis 35 3.288 1.6
Pontocerebellar hypoplasia 36 3.101 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.100 4.6e-11
osteosarcoma -1.497 1.8e-05

Gene RIF (2)

AA Sequence

MVMVLSESLSTRGADSIACGTFSRELHTPKKMSQGPTLFSCGIMENDRWRDLDRKCPLQIDQPSTSIWEC      1 - 70
LPEKDSSLWHREAVTACAVTSLIKDLSISDHNGNPSAPPSKRQCRSLSFSDEMSSCRTSWRPLGSKVWTP     71 - 140
VEKRRCYSGGSVQRYSNGFSTMQRSSSFSLPSRANVLSSPCDQAGLHHRFGGQPCQGVPGSAPCGQAGDT    141 - 210
WSPDLHPVGGGRLDLQRSLSCSHEQFSFVEYCPPSANSTPASTPELARRSSGLSRSRSQPCVLNDKKVGV    211 - 280
KRRRPEEVQEQRPSLDLAKMAQNCQTFSSLSCLSAGTEDCGPQSPFARHVSNTRAWTALLSASGPGGRTP    281 - 350
AGTPVPEPLPPSFDDHLACQEDLSCEESDSCALDEDCGRRAEPAAAWRDRGAPGNSLCSLDGELDIEQIE    351 - 420
KN                                                                        421 - 422
//

Text Mined References (13)

PMID Year Title