Property Summary

NCBI Gene PubMed Count 17
PubMed Score 20.25
PubTator Score 4.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.200 1.8e-04
astrocytic glioma -1.500 1.3e-02
ependymoma -2.400 5.8e-11
oligodendroglioma -1.400 3.4e-02
cutaneous lupus erythematosus 1.200 3.9e-02
glioblastoma -3.300 2.6e-07
osteosarcoma -2.727 6.2e-05
atypical teratoid / rhabdoid tumor -3.000 1.8e-08
medulloblastoma -1.900 3.1e-06
medulloblastoma, large-cell -2.200 8.5e-07
primitive neuroectodermal tumor -1.700 5.1e-03
intraductal papillary-mucinous carcinoma... 1.400 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.3e-02
adult high grade glioma -2.500 2.7e-04
pilocytic astrocytoma -1.500 1.5e-03
primary Sjogren syndrome 1.200 1.0e-02
subependymal giant cell astrocytoma -2.055 3.3e-03
Pick disease -1.300 1.5e-02
Breast cancer 1.500 2.4e-07

Synonym

Accession Q9NUQ9 Q96AZ5 Q9NW21 Q9NZE7
Symbols L1
BM-009

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (2)

PMID Text
25284053 Three proteins-matrix metalloproteinase-9, neutrophil elastase, and FAM49B-were significantly lower in abundance in samples from women with endometriosis.
21555518 FAM49B is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.

AA Sequence

MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHP      1 - 70
ADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTL     71 - 140
RFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVS    141 - 210
ENKNLPIENTTDCLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKID    211 - 280
MKGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIKSMLQ                              281 - 324
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25284053 2015 Urine, peritoneal fluid and omental fat proteomes of reproductive age women: Endometriosis-related changes and associations with endocrine disrupting chemicals.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.