Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.310 2.6e-02
adult high grade glioma -1.500 1.8e-03
astrocytic glioma -1.200 6.7e-03
atypical teratoid / rhabdoid tumor -2.200 1.2e-06
Breast cancer -1.500 1.4e-20
cutaneous lupus erythematosus 2.100 3.6e-03
cystic fibrosis -2.200 4.6e-06
diabetes mellitus -1.100 5.3e-03
ependymoma -1.100 1.3e-02
gastric carcinoma 1.300 3.4e-02
glioblastoma -1.300 1.6e-04
group 3 medulloblastoma -2.000 8.0e-03
interstitial cystitis 1.100 4.5e-03
invasive ductal carcinoma -1.800 4.1e-04
lung cancer -2.900 9.0e-05
lung carcinoma -1.500 1.7e-13
malignant mesothelioma -1.600 2.0e-06
medulloblastoma, large-cell -2.300 4.6e-04
mucosa-associated lymphoid tissue lympho... 1.785 2.9e-02
non-small cell lung cancer -1.608 4.0e-17
oligodendroglioma -1.500 1.8e-02
osteosarcoma -1.364 3.8e-06
Pick disease -1.300 2.6e-04
pituitary cancer -1.800 3.4e-08
primitive neuroectodermal tumor -1.100 2.5e-02
ulcerative colitis 1.700 1.4e-04

Gene RIF (1)

AA Sequence

MGNLLKVLTREIENYPHFFLDFENAQPTEGEREIWNQISAVLQDSESILADLQAYKGAGPEIRDAIQNPN      1 - 70
DIQLQEKAWNAVCPLVVRLKRFYEFSIRLEKALQSLLESLTCPPYTPTQHLEREQALAKEFAEILHFTLR     71 - 140
FDELKMRNPAIQNDFSYYRRTISRNRINNMHLDIENEVNNEMANRMSLFYAEATPMLKTLSNATMHFVSE    141 - 210
NKTLPIENTTDCLSTMTSVCKVMLETPEYRSRFTSEETLMFCMRVMVGVIILYDHVHPVGAFCKTSKIDM    211 - 280
KGCIKVLKEQAPDSVEGLLNALRFTTKHLNDESTSKQIRAMLQ                               281 - 323
//

Text Mined References (13)

PMID Year Title