Property Summary

NCBI Gene PubMed Count 7
PubMed Score 13.93
PubTator Score 5.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (1)

AA Sequence

MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASY      1 - 70
ILASHNGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNG     71 - 140
HDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGD    141 - 210
FQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKI    211 - 280
ESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQ    281 - 350
PAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGMS                                   351 - 389
//

Text Mined References (10)

PMID Year Title