Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.89
PubTator Score 3.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
osteosarcoma -4.165 1.3e-03
chronic lymphosyte leukemia -1.200 1.3e-06
periodontitis 2.300 1.3e-32
primary pancreatic ductal adenocarcinoma -1.527 3.7e-03
tuberculosis -1.200 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.800 4.9e-03
colon cancer -2.600 2.1e-02
lung cancer -1.100 4.8e-04
active Crohn's disease 1.152 2.3e-02
pancreatic cancer -1.500 1.8e-04
interstitial cystitis 3.000 1.1e-04
spina bifida -1.665 4.0e-02
mucosa-associated lymphoid tissue lympho... 1.786 2.2e-02
ulcerative colitis 1.800 1.1e-03
ovarian cancer -2.100 7.7e-06
Breast cancer -1.300 4.0e-02
chronic rhinosinusitis -1.645 2.8e-02

Synonym

Accession Q5VWP2 A3KMG2 Q8NE25 Q9NXK0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
21994415 Data indicate that when cases with FAM46C deletion or mutation were considered together, they were strongly associated with impaired overall survival (OS) in the intensive treatment setting.

AA Sequence

MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVR      1 - 70
LNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQ     71 - 140
KLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTV    141 - 210
IGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPD    211 - 280
ILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA    281 - 350
TNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN                                 351 - 391
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21994415 2011 Mapping of chromosome 1p deletions in myeloma identifies FAM46C at 1p12 and CDKN2C at 1p32.3 as being genes in regions associated with adverse survival.
21478870 2011 A diverse range of gene products are effectors of the type I interferon antiviral response.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.