Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.42
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 3.9e-03
Breast cancer -1.300 5.2e-06
cystic fibrosis -1.916 5.5e-06
ependymoma 1.500 8.1e-04
lung adenocarcinoma -1.700 3.8e-19
non-small cell lung cancer -1.800 4.0e-17
osteosarcoma 1.857 1.7e-04
pituitary cancer -1.100 1.8e-02
primary Sjogren syndrome -1.300 5.3e-03
spina bifida -2.278 3.6e-02

AA Sequence

MMPSESGAERRDRAAAQVGTAAATAVATAAPAGGGPDPEALSAFPGRHLSGLSWPQVKRLDALLSEPIPI      1 - 70
HGRGNFPTLSVQPRQIVQVVRSTLEEQGLHVHSVRLHGSAASHVLHPESGLGYKDLDLVFRVDLRSEASF     71 - 140
QLTKAVVLACLLDFLPAGVSRAKITPLTLKEAYVQKLVKVCTDSDRWSLISLSNKSGKNVELKFVDSVRR    141 - 210
QFEFSIDSFQIILDSLLLFGQCSSTPMSEAFHPTVTGESLYGDFTEALEHLRHRVIATRSPEEIRGGGLL    211 - 280
KYCHLLVRGFRPRPSTDVRALQRYMCSRFFIDFPDLVEQRRTLERYLEAHFGGADAARRYACLVTLHRVV    281 - 350
NESTVCLMNHERRQTLDLIAALALQALAEQGPAATAALAWRPPGTDGVVPATVNYYVTPVQPLLAHAYPT    351 - 420
WLPCN                                                                     421 - 425
//

Text Mined References (11)

PMID Year Title