Property Summary

NCBI Gene PubMed Count 24
PubMed Score 9.85
PubTator Score 8.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Synonym

Accession Q96IP4 A8K7U4 Q5TF86 Q8NFZ9 Q9BW32 Q9NXV5
Symbols XTP11
C6orf37

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Pathway (1)

Gene RIF (9)

PMID Text
25884493 Genotype frequencies of cd (four and five VNTR repeats) and cc (four VNTR repeats homozygote) of the FAM46A gene were significantly decreased in the patients compared to the healthy controls in the Croatian and Norwegian subjects
25231575 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
24625963 VNTR in the coding region of the FAM46A gene, FAM46A rs11040 SNP and BAG6 rs3117582 SNP are associated with susceptibility to tuberculosis
20734064 Observational study of gene-disease association. (HuGE Navigator)
17803723 Genetic analysis of FAM46A in Spanish families with autosomal recessive retinitis pigmentosa: characterization of novel VNTRs is reported.
16924696 Observational study of genotype prevalence. (HuGE Navigator)
16545789 Observational study of gene-disease association. (HuGE Navigator)
16545789 A novel VNTR polymorphism in C6orf37 exists in Chinese population and is not associated with colorectal cancer risk
12054608 a candidate of human retinal disease on chromosome 6

AA Sequence

MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQ      1 - 70
VQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDL     71 - 140
DLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCNDSDRWSLISLSNNS    141 - 210
GKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKII    211 - 280
ATRNPEEIRGGGLLKYCNLLVRGFRPASDEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDR    281 - 350
KYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADANFSNYY    351 - 420
IAQVQPVFTCQQQTYSTWLPCN                                                    421 - 442
//

Text Mined References (24)

PMID Year Title
25884493 2015 Association of the FAM46A gene VNTRs and BAG6 rs3117582 SNP with non small cell lung cancer (NSCLC) in Croatian and Norwegian populations.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25231575 2015 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
24625963 2014 Association of variable number of tandem repeats in the coding region of the FAM46A gene, FAM46A rs11040 SNP and BAG6 rs3117582 SNP with susceptibility to tuberculosis.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22976474 2012 A meta-analysis of genome-wide association studies of breast cancer identifies two novel susceptibility loci at 6q14 and 20q11.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
17803723 2008 Genetic analysis of FAM46A in Spanish families with autosomal recessive retinitis pigmentosa: characterisation of novel VNTRs.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16924696 2006 [VNTR polymorphism of C6orf37 in Chinese population].
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16545789 2006 Identification of a novel VNTR polymorphism in C6orf37 and its association with colorectal cancer risk in Chinese population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054608 2002 Identification and characterization of C6orf37, a novel candidate human retinal disease gene on chromosome 6q14.