Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 3.7e-04
ependymoma -1.300 1.5e-08
glioblastoma -1.200 2.1e-04
group 3 medulloblastoma -2.500 9.5e-06
lung adenocarcinoma 1.100 7.8e-05
medulloblastoma, large-cell -1.400 8.0e-04
osteosarcoma 1.205 6.0e-04
pediatric high grade glioma -1.300 6.4e-04
pituitary cancer 1.600 1.7e-05
primitive neuroectodermal tumor -1.500 1.2e-03

Gene RIF (1)

AA Sequence

MLPWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDP      1 - 70
TYTVWYLGNAVTLHAKGDGCTDDAVGKIWARCGPGGGTKMKLTLGPHGIRMQPCERSAAGGSGGRRPAHA     71 - 140
YLLPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVLLARAHKARALARLLRQTALAAFSDFKRLQR    141 - 210
QSDARHVRQQHLRAGGAAASVPRAPLRRLLNAKCAYRPPPSERSRGAPRLSSIQEEDEEEEEDDAEEQEG    211 - 280
GVPQRERPEVLSLARELRTCSLRGAPAPPPPAQPRRWKAGPRERAGQAR                         281 - 329
//

Text Mined References (5)

PMID Year Title