Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
juvenile dermatomyositis 1.292 1.7e-12
adrenocortical carcinoma 1.574 4.2e-04
primary pancreatic ductal adenocarcinoma 1.088 1.8e-03
tuberculosis -2.100 2.7e-07
cystic fibrosis -1.100 5.1e-03
group 4 medulloblastoma -2.000 3.3e-07
psoriasis 2.100 8.5e-103
invasive ductal carcinoma -1.600 1.0e-03
spina bifida -1.235 4.9e-02
Breast cancer -1.100 7.6e-08
ovarian cancer 1.400 9.7e-04
pituitary cancer -1.700 1.6e-06

AA Sequence

MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKKLHITSEDPTY      1 - 70
TVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMKLTVSAQGIRMVHAEERALRRPGHLYLLHRV     71 - 140
TYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLLYQTSANALAEFKRLKRRDDARH    141 - 210
QQQELVGAHTIPLVPLRKLLLHGPCCYKPPVERSRSAPKLGSITEDLLGEQLEQELQEEEEEEQPEGCPE    211 - 280
EEENRAAEGDPAEEEAEAQRALVVAMHFECGDLLDTLENGRGEALGGGGGSLGPGAGPPPLLLGSASDMK    281 - 350
AELSQLISDLGELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSRQADGASADEP    351 - 420
HSG                                                                       421 - 423
//

Text Mined References (5)

PMID Year Title
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.