Property Summary

NCBI Gene PubMed Count 25
PubMed Score 55.61
PubTator Score 13.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.832 3.4e-02
Multiple myeloma 1.239 6.4e-03
osteosarcoma 1.389 1.3e-03
chronic lymphosyte leukemia 1.100 2.7e-03
medulloblastoma, large-cell -1.300 9.5e-04
Duchenne muscular dystrophy 1.392 9.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.336 5.2e-03
hereditary spastic paraplegia -1.102 7.8e-03
juvenile dermatomyositis 1.123 1.1e-07
Amyotrophic Lateral Sclerosis 1.010 4.9e-05
active Crohn's disease 1.259 8.5e-03
active ulcerative colitis 1.058 2.0e-02
Pick disease -1.100 1.6e-02
ovarian cancer -1.400 1.1e-02
pituitary cancer -1.100 7.8e-05

 GO Function (1)

Gene RIF (10)

PMID Text
26498278 FAM3C expression was dramatically increased in esophageal squamous cell carcinoma and might serve as a valuable prognostic indicator for esophageal squamous cell carcinoma patients after surgery
25212966 Altered subcellular ILEI localization strongly correlates with high tumor cell-associated uPAR protein expression.
24738665 Our findings indicate that cytoplasmic ILEI expression is a potential marker of EMT and tumour progression in colorectal cancer. ILEI is an independent predictive factor associated with poor prognosis in colorectal cancer.
24072492 ILEI could induce, as well as maintain, CD24(low)CD44(high) subpopulation in A549 cells treated with TGF-beta, which might explain its capability to induce metastatic progression.
22159821 At the FAM3C gene locus where rs7776725 was located, we identified several other SNPs (rs4727922, rs1803389, rs718766 and rs7793554) that were also associated with BMD.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19396169 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19109932 Data show that FAM3C is decreased in the CSF of temporal lobe epilepsy patients.
16959614 ILEI is overexpressed and/or altered in intracellular localization in multiple human tumors.
12160727 A cytokine-like protein found in almost all tissues.

AA Sequence

MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFA      1 - 70
FKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQ     71 - 140
DGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYE    141 - 210
GWPEVVEMEGCIPQKQD                                                         211 - 227
//

Text Mined References (30)

PMID Year Title
26498278 2015 Prognostic significance of FAM3C in esophageal squamous cell carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25212966 2014 Interleukin-like epithelial-to-mesenchymal transition inducer activity is controlled by proteolytic processing and plasminogen-urokinase plasminogen activator receptor system-regulated secretion during breast cancer progression.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24738665 2014 ILEI: a novel marker for epithelial-mesenchymal transition and poor prognosis in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24072492 2014 ILEI drives epithelial to mesenchymal transition and metastatic progression in the lung cancer cell line A549.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22792070 2012 Meta-analysis of genome-wide scans for total body BMD in children and adults reveals allelic heterogeneity and age-specific effects at the WNT16 locus.
22159821 2012 A follow-up association study of two genetic variants for bone mineral density variation in Caucasians.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19396169 2009 A large-scale genome-wide association study of Asian populations uncovers genetic factors influencing eight quantitative traits.
19109932 2009 Proteomic analysis of cerebrospinal fluid from patients with idiopathic temporal lobe epilepsy.
19015638 2009 ILEI requires oncogenic Ras for the epithelial to mesenchymal transition of hepatocytes and liver carcinoma progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959614 2006 ILEI: a cytokine essential for EMT, tumor formation, and late events in metastasis in epithelial cells.
16406369 2006 GG: a domain involved in phage LTF apparatus and implicated in human MEB and non-syndromic hearing loss diseases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16215274 2006 Biomarker discovery from pancreatic cancer secretome using a differential proteomic approach.
15985535 2005 Identification of proteins released by pancreatic cancer cells by multidimensional protein identification technology: a strategy for identification of novel cancer markers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12160727 2002 Cloning, expression, and initial characterization of a novel cytokine-like gene family.
9847074 1998 Toward a complete human genome sequence.