Property Summary

NCBI Gene PubMed Count 21
PubMed Score 97.73
PubTator Score 91.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -2.100 7.4e-04
interstitial cystitis -3.900 2.9e-03
nasopharyngeal carcinoma -2.200 1.8e-02
pancreatic cancer -1.700 7.6e-04
pituitary cancer -1.900 6.0e-06
primary pancreatic ductal adenocarcinoma -1.830 5.2e-04
psoriasis -1.300 4.0e-36
spina bifida -1.704 2.7e-02

Gene RIF (11)

AA Sequence

MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCP      1 - 70
SDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTK     71 - 140
FIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHS    141 - 210
DAKNNRYSGWPAEIQIEGCIPKERS                                                 211 - 235
//

Text Mined References (21)

PMID Year Title