Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.70
PubTator Score 0.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.8e-06
diabetes mellitus 1728 1.0e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.400 1.0e-03
ovarian cancer 1.600 4.8e-06

Gene RIF (3)

AA Sequence

MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE      1 - 70
KRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK                                 71 - 112
//

Text Mined References (14)

PMID Year Title