Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.19
PubTator Score 1.26

Knowledge Summary

Patent (2,132)

Expression

  Differential Expression (23)

Disease log2 FC p
pancreatic cancer -1.200 9.0e-05
glioblastoma multiforme 1.100 3.1e-08
osteosarcoma -2.762 1.1e-04
atypical teratoid / rhabdoid tumor -1.300 3.7e-03
group 4 medulloblastoma -1.700 2.6e-04
medulloblastoma, large-cell -2.000 2.3e-04
juvenile dermatomyositis 2.251 4.5e-09
tuberculosis 2.500 2.5e-05
intraductal papillary-mucinous carcinoma... -2.000 3.9e-02
active Crohn's disease 4.324 4.4e-05
ulcerative colitis 4.200 5.2e-09
sarcoidosis 2.500 1.1e-02
Breast cancer 4.300 2.2e-02
interstitial cystitis 2.100 2.0e-02
cystic fibrosis 1.900 5.2e-05
pilocytic astrocytoma 1.100 2.5e-03
primary Sjogren syndrome 2.600 1.3e-06
pancreatic carcinoma -1.200 9.0e-05
psoriasis 1.700 4.4e-08
subependymal giant cell astrocytoma 2.793 1.2e-02
invasive ductal carcinoma 2.276 5.9e-05
ovarian cancer -2.600 1.0e-05
head and neck cancer and chronic obstruc... 2.200 2.6e-03

Gene RIF (2)

PMID Text
25082827 FAM26Fwas found to be consistently and significantly overexpressed in ulcerative colitis patients.
23333304 HIV-1 Vif downregulates the expression of family with sequence similarity 26, member F (FAM26F) in Vif-expression T cells

AA Sequence

MEKFRAVLDLHVKHHSALGYGLVTLLTAGGERIFSAVAFQCPCSAAWNLPYGLVFLLVPALALFLLGYVL      1 - 70
SARTWRLLTGCCSSARASCGSALRGSLVCTQISAAAALAPLTWVAVALLGGAFYECAATGSAAFAQRLCL     71 - 140
GRNRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIFTSVTRCLSPVSFLQLKFW    141 - 210
KIYLEQEQQILKSKATEHATELAKENIKCFFEGSHPKEYNTPSMKEWQQISSLYTFNPKGQYYSMLHKYV    211 - 280
NRKEKTHSIRSTEGDTVIPVLGFVDSSGINSTPEL                                       281 - 315
//

Text Mined References (6)

PMID Year Title
27645024 2016 FAM26F: An Enigmatic Protein Having a Complex Role in the Immune System.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.