Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent (108)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.4e-37
mucosa-associated lymphoid tissue lymphoma 484 6.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.128 6.4e-03
psoriasis -1.300 5.4e-37

Synonym

Accession Q8N5C1 B2RDJ9 B3KSR3
Symbols FAM26E
C6orf188
dJ493F7.3

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 Collection (1)

AA Sequence

MDAFQGILKFFLNQKTVIGYSFMALLTVGSERLFSVVAFKCPCSTENMTYGLVFLFAPAWVLLILGFFLN      1 - 70
NRSWRLFTGCCVNPRKIFPRGHSCRFFYVLGQITLSSLVAPVMWLSVALLNGTFYECAMSGTRSSGLLEL     71 - 140
ICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLICSASFFSLLTTCYARCRSKVSYL    141 - 210
QLSFWKTYAQKEKEQLENTFLDYANKLSERNLKCFFENKRPDPFPMPTFAAWEAASELHSFHQSQQHYST    211 - 280
LHRVVDNGLQLSPEDDETTMVLVGTAHNM                                             281 - 309
//

Text Mined References (5)

PMID Year Title