Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
interstitial cystitis 2312 2.5e-04
osteosarcoma 7950 4.6e-04

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.300 2.5e-04
osteosarcoma -1.245 4.6e-04

 Compartment GO Term (2)

AA Sequence

MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAK      1 - 70
LQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYS     71 - 140
SAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSTCSCCWCCLGDSSSCTLQ                141 - 198
//

Text Mined References (8)

PMID Year Title