Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.014 4.6e-03
adult high grade glioma -1.700 2.8e-04
astrocytic glioma -1.400 3.7e-02
atypical teratoid / rhabdoid tumor -1.900 3.1e-07
ependymoma -1.300 1.2e-06
glioblastoma -2.000 2.0e-05
group 4 medulloblastoma -1.300 4.9e-03
medulloblastoma, large-cell -2.400 8.9e-06
osteosarcoma -1.192 3.5e-04
primitive neuroectodermal tumor -1.100 1.0e-02
subependymal giant cell astrocytoma -1.230 4.7e-02

Synonym

Accession Q9NTX9 B3KWH1 Q9NTA3
Symbols C20orf177
dJ551D2.5

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

AA Sequence

MNAGPSWNKVQHSKNSSGKRQSKSQVPHASSQPRSSLTAVTQPTEEKLKESISPEARRKRNPLGSRCQGA      1 - 70
SGNKLFLDFQSMKIIKENADEDSASDLSDSERIPIPPSPLTPPDLNLRAEEIDPVYFDLHPGQGHTKPEY     71 - 140
YYPNFLPSPFSSWDLRDMALLLNAENKTEAVPRVGGLLGKYIDRLIQLEWLQVQTVQCEKAKGGKARPPT    141 - 210
APGTSGALKSPGRSKLIASALSKPLPHQEGASKSGPSRKKAFHHEEIHPSHYAFETSPRPIDVLGGTRFC    211 - 280
SQRQTLEMRTEEKKKKSSKSTKLQRWDLSGSGSSSKVETSGHIRVPKQAAVILDSADSCKASKTQAHAHP    281 - 350
RKKGKAESCGHATVSSEKKLKTNGVKQNTYKLK                                         351 - 383
//

Text Mined References (8)

PMID Year Title