Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 2.600 2.8e-04
lung adenocarcinoma -1.500 1.9e-03
lung carcinoma -3.000 1.0e-06
nasopharyngeal carcinoma -2.500 8.2e-08
non-small cell lung carcinoma -1.500 7.6e-07
psoriasis -1.300 3.8e-03

AA Sequence

MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQ      1 - 70
QLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN      71 - 139
//

Text Mined References (6)

PMID Year Title