Property Summary

NCBI Gene PubMed Count 16
PubMed Score 27.53
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
medulloblastoma -1.100 2.1e-04
medulloblastoma, large-cell -1.100 7.4e-03
facioscapulohumeral dystrophy 1.800 1.7e-03
pancreatic ductal adenocarcinoma liver m... -1.618 4.2e-02
tuberculosis 1.600 2.8e-06
non-small cell lung cancer 1.252 2.0e-14
intraductal papillary-mucinous neoplasm ... -1.400 2.0e-02
Hydrolethalus syndrome -2.414 9.9e-03
active ulcerative colitis -1.963 3.7e-03
breast carcinoma -1.400 7.3e-03
interstitial cystitis -1.800 1.2e-03
cystic fibrosis 1.200 8.7e-04
non primary Sjogren syndrome sicca 1.300 4.2e-02
Breast cancer 1.100 9.9e-09
ductal carcinoma in situ -1.500 3.1e-02
invasive ductal carcinoma -1.600 8.2e-03
acute myeloid leukemia -1.800 3.3e-03
ovarian cancer -2.400 6.1e-07

Gene RIF (4)

PMID Text
26438880 results suggest that adipocyte-derived PAMM may suppress macrophage activation by inhibiting MAPK signalling pathway.
26402163 Antioxidant stress induces PAMM mRNA expression in human peripheral blood mononuclear cells .
20877624 Observational study of gene-disease association. (HuGE Navigator)
19951071 The PAMM is a redox regulatory protein that modulates osteoclast differentiation in vitro. PAMM expression may affect bone resorption in vivo and help to maintain bone mass.

AA Sequence

MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELW      1 - 70
EKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKF     71 - 140
YGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLL    141 - 210
SVLEAAKMIKPQTLASEKK                                                       211 - 229
//

Text Mined References (19)

PMID Year Title
26438880 2015 Adipocyte-derived PAMM suppresses macrophage inflammation by inhibiting MAPK signalling.
26402163 2015 A short report: PAMM, a novel antioxidant protein, induced by oxidative stress.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19951071 2010 PAMM: a redox regulatory protein that modulates osteoclast differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14710190 2004 Reconsidering the evolution of eukaryotic selenoproteins: a novel nonmammalian family with scattered phylogenetic distribution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.