Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.89
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
inflammatory breast cancer -1.200 4.6e-03
lung cancer 1.300 4.6e-02
malignant mesothelioma 1.200 2.9e-06
medulloblastoma 1.100 4.0e-03
osteosarcoma -3.048 5.2e-07
ovarian cancer -2.000 4.3e-09
pancreatic ductal adenocarcinoma liver m... -1.287 6.8e-03
tuberculosis 1.400 3.3e-08

Gene RIF (3)

AA Sequence

MAGLLALLGPAGRVGARVRPRATWLLGATAPCAPPPLALALLPPRLDARLLRTARGDCRGHQDPSQATGT      1 - 70
TGSSVSCTEEKKQSKSQQLKKIFQEYGTVGVSLHIGISLISLGIFYMVVSSGVDMPAILLKLGFKESLVQ     71 - 140
SKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPLIVRYFRKVGFFKPPAAKP                      141 - 192
//

Text Mined References (11)

PMID Year Title