Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary


No data available



Accession Q5JX71 Q05C43
Symbols C20orf106


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

SGSNLRLRKSEMPADPYHVTICEIWGEESSS                                           141 - 171

Text Mined References (7)

PMID Year Title