Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.45
PubTator Score 0.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Down syndrome 499 3.232 1.6

Expression

Synonym

Accession Q9NSI2
Symbols PRED56
C21orf70

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGKVRGLRARVHQAAVRPKGEAAPGPAPPAPEATPPPASAAGKDWAFINTNIFARTKIDPSALVQKLELD      1 - 70
VRSVTSVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKLRREQWLQKIEAIKLAEQKHREERRRRATVV     71 - 140
VGDLHPLRDALPELLGLEAGSRRQARSRESNKPRPSELSRMSAAQRQQLLEEERTRFQELLASPAYRASP    141 - 210
LVAIGQTLARQMQLEDGGQL                                                      211 - 230
//

Text Mined References (16)

PMID Year Title