Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis -1.110 2.6e-02
astrocytic glioma -1.100 1.0e-02
atypical teratoid / rhabdoid tumor -1.900 1.4e-07
cystic fibrosis -1.321 9.8e-06
ependymoma -1.200 2.9e-02
glioblastoma -1.200 3.5e-04
medulloblastoma -1.200 1.3e-06
medulloblastoma, large-cell -1.700 7.9e-04
oligodendroglioma -1.600 5.3e-03
osteosarcoma -1.357 4.1e-03
ovarian cancer -1.400 1.8e-03
pediatric high grade glioma -1.600 7.0e-06
subependymal giant cell astrocytoma -1.552 1.7e-02
tuberculosis 1.100 2.3e-03

Synonym

Accession P0CF97
Symbols C4orf53

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA

Gene RIF (1)

AA Sequence

MDHFFIKRKRNSEVKYTEACSSSSVESGIVNSDNIEKNTDSNLQTSTSFEPHFKKKKVSARRYNEDYLKY      1 - 70
GFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDIKLSTQFLSCST     71 - 140
AVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFDDKSADKLKTIPNDNTVSLRICTIAEH    141 - 210
LETMLITRLQSGIDFAIQLDESTDIGSCTTLLVYVRYAWQDDFLEDFLCFLNLTSHLSGLDIFTELERRI    211 - 280
VGQYKLNWKNCKGITSDGTATMTGKHSRVIKKLLEVTNNGAVWNHCFIHREGLASREIPQNLMEVLKNAV    281 - 350
KVVNFIKGSSLNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIF    351 - 420
EDDTWVTKLAYLTDIFSILNELSLKLQGKNSDVFQHVERIQGFRKTLLLWQVRLKSNRPSYYMFPRFLQH    421 - 490
IEENIINENILKEIKLEILLHLTSLSQTFNHFFPEEKFETLRENSWVKDPFAFRHPESIIELNLVPEEEN    491 - 560
ELLQLSSSYTLKNDYETLSLSAFWMKVKEDFPLLSRKSVLLLLPFTTTSLCELGFSILTQLKTKERNGLN    561 - 630
CAAVMRVALSSCVPDWNELMNRQAHPS                                               631 - 657
//

Text Mined References (4)

PMID Year Title