Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.95
PubTator Score 1.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
pancreatic cancer 1.400 1.1e-04
adult high grade glioma -1.900 1.2e-06
atypical teratoid / rhabdoid tumor -3.600 9.9e-06
ependymoma -1.400 4.6e-04
glioblastoma -1.800 5.0e-04
group 3 medulloblastoma -2.200 2.6e-04
medulloblastoma, large-cell -2.700 3.7e-04
osteosarcoma 2.182 4.5e-02
ovarian cancer -1.100 2.4e-05
primary pancreatic ductal adenocarcinoma 1.312 4.1e-03
psoriasis -1.100 1.0e-19
subependymal giant cell astrocytoma -3.342 3.7e-02

Gene RIF (1)

AA Sequence

MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCAC      1 - 70
RKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS             71 - 132
//

Text Mined References (13)

PMID Year Title