Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.03
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (1)

AA Sequence

MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRIEERSQTVKCS      1 - 70
CFSGQVAGTTRAKPSCVDASIVLQRWWCQMEPCLPGEECKVLPDLSGWSCSSGHKVKTTKVTR            71 - 133
//

Text Mined References (6)

PMID Year Title