Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.68
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.700 1.2e-03
posterior fossa group A ependymoma -3.200 2.4e-10
oligodendroglioma -2.300 3.4e-14
glioblastoma -3.900 2.8e-05
osteosarcoma -2.204 4.2e-04
medulloblastoma -2.900 9.9e-04
atypical teratoid / rhabdoid tumor -3.100 5.0e-05
medulloblastoma, large-cell -3.600 2.2e-03
primitive neuroectodermal tumor -2.800 1.8e-03
interstitial cystitis -2.800 3.9e-05
adult high grade glioma -3.400 3.3e-04
pilocytic astrocytoma -2.000 1.3e-03
pituitary cancer -2.300 6.3e-06

Synonym

Accession Q8N3H0 B3KVV4 Q4G0R9 Q68DK0 Q6GTX6
Symbols TAFA2
TAFA-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
25112515 Variants of FAM19A2 (rs348644) are associated with forced expiratory volume in COPD.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCF      1 - 70
PGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH              71 - 131
//

Text Mined References (14)

PMID Year Title
25112515 2014 Admixture mapping identifies a quantitative trait locus associated with FEV1/FVC in the COPDGene Study.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028294 2004 TAFA: a novel secreted family with conserved cysteine residues and restricted expression in the brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.