Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.71
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.400 3.3e-04
astrocytic glioma -2.700 1.2e-03
Astrocytoma, Pilocytic -1.900 1.9e-03
atypical teratoid / rhabdoid tumor -3.100 5.0e-05
ependymoma -3.100 6.0e-03
glioblastoma -2.900 8.9e-07
interstitial cystitis -2.600 7.7e-04
medulloblastoma -2.000 3.7e-03
medulloblastoma, large-cell -3.600 2.2e-03
oligodendroglioma -1.400 4.8e-02
osteosarcoma -2.204 4.2e-04
pituitary cancer -2.300 6.3e-06
primitive neuroectodermal tumor -2.800 1.8e-03

Synonym

Accession Q8N3H0 B3KVV4 Q4G0R9 Q68DK0 Q6GTX6
Symbols TAFA2
TAFA-2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCF      1 - 70
PGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH              71 - 131
//

Text Mined References (15)

PMID Year Title