Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma multiforme 1.200 2.4e-20
osteosarcoma -1.714 3.1e-03
atypical teratoid / rhabdoid tumor -1.300 7.8e-05
medulloblastoma -1.200 3.7e-05
medulloblastoma, large-cell -2.000 6.0e-04
non-small cell lung cancer 1.842 5.5e-19
intraductal papillary-mucinous neoplasm ... 1.800 1.3e-03
breast carcinoma 1.300 6.8e-28
ductal carcinoma in situ 1.400 3.0e-04
invasive ductal carcinoma 1.100 5.0e-03
ovarian cancer -1.100 2.2e-04

AA Sequence

MSDEASAITSYEKFLTPEEPFPLLGPPRGVGTCPSEEPGCLDISDFGCQLSSCHRTDPLHRFHTNRWNLT      1 - 70
SCGTSVASSEGSEELFSSVSVGDQDDCYSLLDDQDFTSFDLFPEGSVCSDVSSSISTYWDWSDSEFEWQL     71 - 140
PGSDIASGSDVLSDVIPSIPSSPCLLPKKKNKHRNLDELPWSAMTNDEQVEYIEYLSRKVSTEMGLREQL    141 - 210
DIIKIIDPSAQISPTDSEFIIELNCLTDEKLKQVRNYIKEHSPRQRPAREAWKRSNFSCASTSGVSGASA    211 - 280
SASSSSASMVSSASSSGSSVGNSASNSSANMSRAHSDSNLSASAAERIRDSKKRSKQRKLQQKAFRKRQL    281 - 350
KEQRQARKERLSGLFLNEEVLSLKVTEEDHEADVDVLM                                    351 - 388
//

Text Mined References (7)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.