Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MAQQNMKVRPVLLKRNSLESVEFVKQPHHRRSKSQQVRFKEDGTTKNPTGLAEVDVQTPEDPAVMGKTQA      1 - 70
TRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGNLSE     71 - 140
QDIVSSDLAYLRLAQHLEDGPRRVKVSHAFLPRVPKVQSNGPVSICLEAGTWRSLEKATAAIQVPDDIYH    141 - 210
SPSWEARESALSPDRSAEVSNSIHPLDDTRPGDGRRVTPLDSEKSTSCLNATSVASHTPGTEELKPELLL    211 - 280
PKDNSDDKDLGSLSSQSKETCVPSSPRTHSSPSQGSHSQPAHPGRASDCPSSSNNHQNLVSLKTNSASKS    281 - 350
APGCQEQTANNPTESDTLEFPNCPGSNHLPSSLSRSETKLQSNREISDINQIHLARGELCDLQGRLQSVE    351 - 420
ESLHSNQEKIKVLLNVIQDLEKARALTEGRNFYRTGQDLNNCSTCQNTACIIYSVEYDFRQQEGRFHEVL    421 - 490
QSLEEAEPVEEASPPPKSPAEPPAPEKQDLRRKTKKVKKKCFWWI                             491 - 535
//

Text Mined References (4)

PMID Year Title