Property Summary

NCBI Gene PubMed Count 12
PubMed Score 26.60
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.200 5.9e-05
osteosarcoma -1.073 6.1e-05
Alzheimer's disease -1.100 2.6e-02
Pick disease -1.200 6.0e-05
ovarian cancer 1.400 3.9e-04
pituitary cancer 1.400 5.4e-05

Gene RIF (3)

PMID Text
24870804 CARP is a potential tumor suppressor of gastric carcinoma and the rs2297882 C>T phenotype of CARP may serve as a predictor of gastric carcinoma.
21499297 results indicated that C10ORF97 functions as a novel tumor suppressor by modulating several key G(1)/S-regulatory proteins by interacting with JAB1
12054670 CARP is a novel caspase recruitment domain containing pro-apoptotic protein. (CARP, CARD containing Protein)

AA Sequence

MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSE      1 - 70
KSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALA     71 - 140
VEELGFERFHALIQKRSFRSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLID    141 - 210
PVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIW    211 - 280
IVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNK    281 - 350
LDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTP    351 - 420
IKRCLQTKWPYIELLWTTDRSPSLN                                                 421 - 445
//

Text Mined References (17)

PMID Year Title
27292798 2016 MINDY-1 Is a Member of an Evolutionarily Conserved and Structurally Distinct New Family of Deubiquitinating Enzymes.
25416956 2014 A proteome-scale map of the human interactome network.
24870804 2014 CARP is a potential tumor suppressor in gastric carcinoma and a single-nucleotide polymorphism in CARP gene might increase the risk of gastric carcinoma.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21499297 2011 C10ORF97 is a novel tumor-suppressor gene of non-small-cell lung cancer and a functional variant of this gene increases the risk of non-small-cell lung cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17652099 2007 Genome-wide mapping of modifier chromosomal loci for human hypertrophic cardiomyopathy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054670 2002 CARP is a novel caspase recruitment domain containing pro-apoptotic protein.