Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.33
PubTator Score 0.10

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


AA Sequence

HSLWAQLGGYPDIPRLLQLEVQSTFRKSLASLQSRVKKIPK                                2311 - 2351

Text Mined References (3)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.