Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.28
PubTator Score 0.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.9e-10
posterior fossa group B ependymoma 1530 7.8e-06
osteosarcoma 7933 1.8e-04

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.021 1.8e-04
posterior fossa group B ependymoma 1.300 7.8e-06
ovarian cancer 1.600 1.9e-10

AA Sequence

MPLEERRSSGERNDAAPTNHRRPGEKRASTAKQVSSVPFLGAAGHQQSLPSSWKASCSGPLVMASDSDVK      1 - 70
MLLNFVNLASSDIKAALDKSAPCRRSVDHRKYLQKQLKRFSQKYSRLPRGLPGRAAEPYLKRGSEDRPRR     71 - 140
LLLDLGPDSSPGGGGGCKEKVLRNPYREECLAKEQLPQRQHPEAAQPGQVPMRKRQLPASFWEEPRPTHS    141 - 210
YHVGLEGGLGPREGPPYEGKKNCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSLVGRVNAWSCCPFQY    211 - 280
HGQPIYPGPLGALPQSPVPSLGLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKPIPTKPAVPPPIFNV    281 - 350
FGYL                                                                      351 - 354
//

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.