Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.13
PubTator Score 3.17

Knowledge Summary


No data available



  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 3.0e-02
atypical teratoid / rhabdoid tumor -1.400 5.6e-06
glioblastoma -1.500 8.7e-06
medulloblastoma, large-cell -1.800 2.0e-05
primitive neuroectodermal tumor -1.300 8.9e-04
hereditary spastic paraplegia -1.028 6.6e-03
tuberculosis -1.100 2.6e-05
Pick disease -1.100 6.7e-03
ovarian cancer -2.200 3.5e-06

AA Sequence

LSKALFAQMGQNLLNQAASQPPHIKKSLEELLDMTILNEL                                 1681 - 1720

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16335990 Detection of hypothetical proteins in human fetal perireticular nucleus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.