Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.12
PubTator Score 0.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma 3.700 2.7e-02
osteosarcoma -1.633 3.2e-06
atypical teratoid / rhabdoid tumor -1.500 9.6e-06
glioblastoma -1.200 3.1e-03
sonic hedgehog group medulloblastoma -1.500 2.1e-05
primitive neuroectodermal tumor -1.400 9.6e-03
acute quadriplegic myopathy 1.756 2.5e-08
diabetes mellitus 1.300 3.8e-03
pediatric high grade glioma -1.100 4.1e-04
nasopharyngeal carcinoma -1.200 9.8e-07
ovarian cancer -1.100 1.7e-04
pituitary cancer -1.400 2.9e-03
chronic rhinosinusitis -1.322 1.6e-02

AA Sequence

MGTRDDVPEAKVLVPVAVYCGSIPRTSAGPRVLPPGSINSSLPHGEGSLQPEPRALLNNEEPSQLLRGLG      1 - 70
QLGGLKLDTPSKGWQARNGHPRNLRALSLGDQPLVLLPSPESEANSVARDTIQIKDKLKKRRLSEGLAAS     71 - 140
SRASLDPGGGPQGVPLHSTIPRATSQRLLRVPRPMPLIQSIPTTPEASGVKEKGLDLPGSIPGPHELRPG    141 - 210
AQEAQISWQYLHCNDEKMQKSLGAIVIPPIPKARTVAATPSRVPGSLPSPLPPGQGVLTGLRAPRTRLAR    211 - 280
GSGPREKTPASLEPKPLASPIRDRPAAAKKPALPFSQSAPTLTAFSFDCAREACPPLKEEDQKEIGTKIQ    281 - 350
VTISKSAREKMQLKQMKEMELLRRLEEPRTGQELTSQCLGSQRAFMKEGLLPLRGSGTLSVPTRLSGPCR    351 - 420
NDVSIILRKWASRASLPSIPISRQEPRFARHASANSLPAVLTLGSPEWEEEEEMDLRACKELRPFSNPEL    421 - 490
GLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLVVTGEVTNLRSKVSHLAISTLGDLFQ    491 - 560
ALKKNMDQEAEEIARCLLQKMADTNEFIQRAAGQSLRAMVENVTLARSLVVLTSAGVYHRNPLIRKYAAE    561 - 630
HLSAVLEQIGAEKLLSGTRDSTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANTKFDAFLKQSLPSYDL    631 - 700
QKVMAAIKQQGIEDNDELPSAKGRKVLRSLVVCENGLPIKEGLSCNGPRLVGLRSTLQGRGEMVEQLREL    701 - 770
TRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMIPLLRES    771 - 840
LHPMLLSIIITVADNLNSKNSGIYAAAVAVLDAMVESLDNLCLLPALAGRVRFLSGRAVLDVTDRLAVLV    841 - 910
ASVYPRKPQAVERHVLPILWHFLNTATRNGTLPGPSGNIRGVVCRLSRSLQEHMGSRLLDFAASQPKHVL    911 - 980
KTLQELLDSESLGGSRKATDRGVAPDSKTTGSSYPFQLD                                   981 - 1019
//

Text Mined References (5)

PMID Year Title
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
20125088 2011 Genome-wide association study of recurrent early-onset major depressive disorder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.