Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.16
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 5.5e-05
diabetes mellitus -1.400 1.4e-03
Endometriosis -1.460 1.5e-02
group 4 medulloblastoma 1.100 2.1e-03
interstitial lung disease -1.200 5.0e-03
juvenile dermatomyositis 1.143 9.7e-11
osteosarcoma 1.626 5.8e-04
ovarian cancer 1.100 4.5e-02
pancreatic ductal adenocarcinoma liver m... -1.034 2.7e-02
tuberculosis -3.300 2.9e-08

Gene RIF (1)

AA Sequence

MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYS      1 - 70
TDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYY     71 - 140
RMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVS    141 - 210
VPP                                                                       211 - 213
//

Text Mined References (13)

PMID Year Title