Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.54
PubTator Score 7.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.200 4.4e-06
osteosarcoma -1.252 4.6e-03
posterior fossa group B ependymoma 1.700 4.0e-07
sonic hedgehog group medulloblastoma 2.500 2.5e-07
atypical teratoid/rhabdoid tumor 1.600 6.7e-07
medulloblastoma, large-cell 2.500 4.2e-05
primitive neuroectodermal tumor 1.300 8.4e-04
diabetes mellitus -1.300 2.2e-03
acute myeloid leukemia -1.200 2.1e-02
ovarian cancer -2.000 1.4e-06
pituitary cancer 1.200 6.9e-05
head and neck cancer -1.100 2.4e-02

Gene RIF (12)

PMID Text
26778126 Demonstrate a mechanism involving IR-induced phosphorylation and dimerization of the BRCT/Abraxas complex for regulating Abraxas-mediated recruitment of BRCA1 in response to IR.
22357538 The recurrent Abraxas c.1082G>A mutation connects to breast cancer predisposition.
21529986 low expression correlates with better response to chemotherapy and longer survival in patients with advanced non small-cell lung cancer
19415121 examined RAP80 and Abraxas expression and their effect on treatment outcome in non-small-cell lung cancer
18695986 it seems unlikely that moderate to highly penetrant alleles of either RAP80 or Abraxas, confer a significantly high relative risk of breast cancer.
18695986 Observational study of gene-disease association. (HuGE Navigator)
18270812 Mutational analysis in 168 multiple-case breast/ovarian cancer families, negative for mutations in BRCA1 or BRCA2, suggests that CCDC98 does not play an important role as a high penetrance breast cancer susceptibility gene.
18270812 Observational study of gene-disease association. (HuGE Navigator)
18077395 the human Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage
17643122 CCDC98 is a mediator of BRCA1 function involved in the mammalian DNA damage response.
17643121 CCDC98 is a BRCA1 binding partner that mediates BRCA1 function in response to DNA damage.
17525340 Abraxas and RAP80 were required for DNA damage resistance, G(2)-M checkpoint control, and DNA repair.

AA Sequence

MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQL      1 - 70
FSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSII     71 - 140
TESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLK    141 - 210
EVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFL    211 - 280
CQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALD    281 - 350
LDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF               351 - 409
//

Text Mined References (29)

PMID Year Title
26778126 2016 Structure of BRCA1-BRCT/Abraxas Complex Reveals Phosphorylation-Dependent BRCT Dimerization at DNA Damage Sites.
25105795 2015 Mislocalization of BRCA1-complex due to ABRAXAS Arg361Gln mutation.
24316840 2013 Preliminary crystallographic studies of BRCA1 BRCT-ABRAXAS complex.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22357538 2012 Breast cancer-associated Abraxas mutation disrupts nuclear localization and DNA damage response functions.
21529986 2011 Tubulin, BRCA1, ERCC1, Abraxas, RAP80 mRNA expression, p53/p21 immunohistochemistry and clinical outcome in patients with advanced non small-cell lung cancer receiving first-line platinum-gemcitabine chemotherapy.
21437268 2011 A genome-wide association study of upper aerodigestive tract cancers conducted within the INHANCE consortium.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19415121 2009 Customized treatment in non-small-cell lung cancer based on EGFR mutations and BRCA1 mRNA expression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19261749 2009 NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control.
19261748 2009 MERIT40 facilitates BRCA1 localization and DNA damage repair.
19261746 2009 MERIT40 controls BRCA1-Rap80 complex integrity and recruitment to DNA double-strand breaks.
18695986 2009 Analysis of the genes coding for the BRCA1-interacting proteins, RAP80 and Abraxas (CCDC98), in high-risk, non-BRCA1/2, multiethnic breast cancer cases.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18270812 2009 Evaluation of the BRCA1 interacting genes RAP80 and CCDC98 in familial breast cancer susceptibility.
18077395 2007 Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage.
17643122 2007 CCDC98 is a BRCA1-BRCT domain-binding protein involved in the DNA damage response.
17643121 2007 CCDC98 targets BRCA1 to DNA damage sites.
17525340 2007 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.