Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.48
PubTator Score 0.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.026 1.1e-06
adult high grade glioma -1.100 1.5e-04
astrocytic glioma -1.300 2.0e-03
Astrocytoma, Pilocytic -1.100 8.0e-08
ductal carcinoma in situ 1.100 2.7e-02
ependymoma -1.100 1.3e-02
gastric carcinoma -1.300 3.4e-02
glioblastoma -1.100 8.9e-09
interstitial cystitis -2.400 4.0e-04
invasive ductal carcinoma 1.300 2.3e-03
lung cancer -1.800 2.4e-05
osteosarcoma -1.822 2.7e-06
ovarian cancer 1.200 3.1e-04
pancreatic cancer -1.300 3.4e-03
pituitary cancer -1.500 1.6e-04
primary pancreatic ductal adenocarcinoma -1.252 1.5e-03
psoriasis -3.400 1.5e-05
pulmonary arterial hypertension -1.400 3.7e-02

AA Sequence

MRAVPLPAPLLPLLLLALLAAPAARASRAESVSAPWPEPERESRPPPGPGPGNTTRFGSGAAGGSGSSSS      1 - 70
NSSGDALVTRISILLRDLPTLKAAVIVAFAFTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAP     71 - 140
LNEEDDEDEDSTVFDIKYR                                                       141 - 159
//

Text Mined References (6)

PMID Year Title