Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.76
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.500 3.1e-03
breast carcinoma 1.300 6.0e-03
medulloblastoma -1.200 3.3e-05
medulloblastoma, large-cell -1.200 6.6e-03
pancreatic ductal adenocarcinoma liver m... -1.350 4.9e-02

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGL      1 - 70
AEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFV     71 - 140
VRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR                        141 - 190
//

Text Mined References (6)

PMID Year Title