Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.51
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.500 3.1e-03
sonic hedgehog group medulloblastoma -1.300 3.9e-03
medulloblastoma, large-cell -1.200 6.6e-03
pancreatic ductal adenocarcinoma liver m... -1.350 4.9e-02
breast carcinoma 1.300 6.0e-03

Synonym

Accession Q8TBP5 A8K0H4
Symbols TMEM157
UNQ1912
HGS_RE408

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGL      1 - 70
AEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFV     71 - 140
VRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR                        141 - 190
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.